KEGG   Kryptolebias marmoratus (mangrove rivulus): 108244269Help
Entry
108244269         CDS       T05608                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II delta 1 chain isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04012  ErbB signaling pathway
kmr04020  Calcium signaling pathway
kmr04114  Oocyte meiosis
kmr04217  Necroptosis
kmr04261  Adrenergic signaling in cardiomyocytes
kmr04310  Wnt signaling pathway
kmr04912  GnRH signaling pathway
kmr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    108244269
   04310 Wnt signaling pathway
    108244269
   04020 Calcium signaling pathway
    108244269
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108244269
   04217 Necroptosis
    108244269
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108244269
   04916 Melanogenesis
    108244269
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108244269
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108244269
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     108244269
Protein kinases [BR:kmr01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   108244269
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 108244269
NCBI-ProteinID: XP_017285815
Position
Unknown
AA seq 513 aa AA seqDB search
MTSTTCTRFTDEYQLYEELGKGAFSVVRRCMKISTGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRVTATDALKHPWICQRSTVASMMHRQETVECLKKFNARRKLK
GAILTTMLATRNFSAAKSLLNKKPDGVKINNKANVVTSPKEPVPTPSLEPQTTVIHNPAD
GNKESSESANTTIEDEDVRARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTSFEPEAL
GNLVEGTDFHRFYFENVLSRGKQPIHTILLNPHVHLIGDEAACIAYIRLTQYIDSNRMPR
TIQSEETRIWHRRDSKWQNIHFHRSGSPTVPTN
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaaccacctgcaccaggttcaccgatgagtatcagctgtacgaggagctgggg
aagggagcgttctctgtggtgaggaggtgcatgaagatctccacagggcaggagtacgct
gctaaaataatcaacaccaagaagctttctgcacgagatcaccagaagctggagcgagag
gccagaatctgccgcctgctgaaacatcccaacatcgttcgactccatgacagcatatca
gaggagggattccactatcttgtctttgacttagttactggaggtgagctgtttgaggat
attgttgccagagagtactacagtgaagctgatgccagtcattgcattcagcagatccta
gaggctgtgctccactgtcaccagatgggtgtggttcatcgtgatctcaagccagagaat
ttgcttctagccagcaagttgaagggagcagcagtgaagctggcagattttggcttggct
atagaagtgcagggagaccagcaagcttggtttgggtttgctggtacaccagggtacctg
tctcctgaggtgctgaggaaagatccttatggcaagcctgtggatatgtgggcctgtggt
gtgatcctgtacatcctcctagtgggatatcctccgttctgggacgaggaccagcacaga
ctctatcagcagattaaagctggagcttatgatttcccttctccagagtgggacacggtg
accccagaagccaaagacctgatcaacaagatgctcaccattaacccatccaagagagtc
actgccacagatgcactcaaacacccttggatctgtcaacgttccactgtggcttcgatg
atgcacagacaggagactgtggagtgtctcaagaaattcaatgccagaaggaaactgaag
ggagctatcctgacaactatgctcgccactcgcaacttttcagcagccaagagcctgctg
aacaaaaaaccagatggtgtcaaaatcaacaacaaggctaatgtggtcaccagccccaaa
gagcctgtccccactccttctctggagcctcaaacaactgttatccacaatccagctgat
ggaaacaaggagtccagtgagagtgcgaacaccaccattgaggacgaagatgtgagagct
cgtaagcaggaaatcattaaagtgacagagcagctgattgaagccatcaacaacggagac
tttgaggcctacacgaagatatgcgatcctggcctcacttccttcgagcctgaggctttg
ggcaacttggtcgagggcacagacttccatcgtttctactttgagaacgttctgtccaga
gggaagcagcccatccacaccatcctgctcaacccccacgtccacctgatcggagacgag
gctgcctgcatcgcctacatccgcctcacgcagtacatagacagcaaccgcatgccccgc
accatccagtcagaggagacccgcatctggcaccgccgcgacagcaagtggcagaacatc
cacttccaccgctctggctcccccaccgttcccaccaactga

DBGET integrated database retrieval system