KEGG   Kryptolebias marmoratus (mangrove rivulus): 108244505Help
Entry
108244505         CDS       T05608                                 

Gene name
st3gal3
Definition
(RefSeq) CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase isoform X2
  KO
K00781  neolactotetraosylceramide alpha-2,3-sialyltransferase (sialyltransferase 6) [EC:2.4.99.6]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00514  Other types of O-glycan biosynthesis
kmr00515  Mannose type O-glycan biosynthesis
kmr00533  Glycosaminoglycan biosynthesis - keratan sulfate
kmr00601  Glycosphingolipid biosynthesis - lacto and neolacto series
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    108244505 (st3gal3)
   00514 Other types of O-glycan biosynthesis
    108244505 (st3gal3)
   00533 Glycosaminoglycan biosynthesis - keratan sulfate
    108244505 (st3gal3)
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    108244505 (st3gal3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kmr01003]
    108244505 (st3gal3)
Enzymes [BR:kmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.6  N-acetyllactosaminide alpha-2,3-sialyltransferase
     108244505 (st3gal3)
Glycosyltransferases [BR:kmr01003]
 Terminal extension
  Sialyltransferase
   108244505 (st3gal3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_29
Motif
Other DBs
NCBI-GeneID: 108244505
NCBI-ProteinID: XP_017286249
UniProt: A0A3Q2ZEM3
Position
Unknown
AA seq 395 aa AA seqDB search
MKPTHKLLFILCPMLVLVFIYYSSEKLQLYVWGQKPQRNTDRDAEAATVALTKGAEVKRF
GEMENDISVGRIVSSVYDKQGFLLQLETKLPLELTYKYGNLSKGACKPGYAAAKMATIYP
KFIKSAPMFLDRNFKRLAKISYYLPPFGIRTQERIIDSILTATKNYGLGEQLDSLSCKRC
IIVGNGGILFNKSLGTRIDDYDVVIRLNEAPVKGYSRDVGTKTTLRITYPEGAIQNPENY
EKDSLFVFSGFKPLDFKWFRQIVFKENVRGLDGFWKSVAHRVPREPTELRILNPFFIQEA
AFQFIGLPFNNGLMGKGNIPTLGTVAITMALHNCDEVAVAGFGYDMSAPHAPLHYYENIK
MSAIRESWTHDISKEKEFLRKLVRANVITDLTKGI
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctacacacaagctgctgtttatcctgtgccccatgctggtcctggtctttatt
tactactcttctgagaagctgcagctatacgtatggggtcagaagcctcagagaaataca
gacagagatgcagaagcggcaactgtagccctgactaaaggtgctgaagtgaaaagattt
ggagagatggagaacgacatcagcgttggacgaatagtaagctcagtgtatgataagcag
ggctttctgctgcagctggaaacaaaactgccactggagctgacatacaagtatggcaac
cttagcaaaggggcgtgcaagccaggatatgcagcagccaagatggctaccatctatccc
aagttcataaaatcagctcccatgtttcttgatcgaaacttcaaacggctagcaaaaatc
agctattacttgcctccatttggcatcagaacacaagagagaataatagacagcatttta
actgccacaaaaaattatggacttggagagcagttggacagtctcagctgtaaaagatgc
atcattgtgggcaacgggggaatcttgtttaataaatctctgggcacccgcatagatgac
tatgatgttgtcataagattgaatgaagccccagtaaaaggctacagcagagacgtaggg
accaaaaccaccctgaggataacatatccagagggagccatccagaatcctgaaaactat
gaaaaagattccctttttgtcttttctggtttcaaaccacttgatttcaagtggttcaga
cagatagtcttcaaggaaaatgtgaggggcttggatggtttctggaagtctgtagcccac
cgtgtgcctcgggagccaacggagctgagaatcctcaatcccttctttatccaagaggct
gcattccagtttataggcctgccattcaacaatggattaatgggcaaagggaacattcca
actttgggaacagttgctataacgatggcgctgcacaactgtgacgaggtggcagtggcg
ggttttggctacgacatgtctgcacctcatgcacctctgcactactacgagaatatcaag
atgtctgctattagagagtcctggacgcacgacatatccaaggagaaagagttccttcgt
aagttggtgagggccaacgtgatcacagatctcaccaaaggaatctga

DBGET integrated database retrieval system