KEGG   Kryptolebias marmoratus (mangrove rivulus): 108244976Help
Entry
108244976         CDS       T05608                                 

Gene name
zdhhc17
Definition
(RefSeq) palmitoyltransferase ZDHHC17
  KO
K20032  palmitoyltransferase ZDHHC13/17 [EC:2.3.1.225]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kmr04131]
    108244976 (zdhhc17)
Enzymes [BR:kmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     108244976 (zdhhc17)
Membrane trafficking [BR:kmr04131]
 SNARE
  SNARE associated proteins
   Palmitoyltransferases
    108244976 (zdhhc17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 DHHC Ank_4 Ank_5 Ank_3 Ank
Motif
Other DBs
NCBI-GeneID: 108244976
NCBI-ProteinID: XP_017287039
Position
Unknown
AA seq 622 aa AA seqDB search
MADAMEEYEKEAGCVPILHPEEIKPQSHYNHGYSENVSRKNHVDDYSTWDIVKATQYGIF
ERCRELVEAGFDVRQPDKENVTLLHWAAINNRIDLVKYYISKGAIVDQLGGDLNSTPLHW
ATRQGHLSMVVQLMKYGADPSLIDGEGCSCVHLAAQFGHTSIVAYLIAKGQDVDMMDQNG
MTPLMWAAYRTHSVDPTRLLLTFNVSVNLGDKYHKNTALHWAVLAGNTTVISLLLDANAN
VDAQNIKGETPLDLAKQRKNVWMINHLQEARQAKGYDSPSYLKRLKMDKEFRQKVMLGTP
FVVIWLVGFVADLDIDSWLIKGIMYAGVWVAVQFLSKAFFDHSMHSALPLGIYMATKFWM
YTTWFYWFWNDLPFATVHIPFLINSLALFYNFGKSWKSDPGIIKASEEQKKKTIVELAET
GSLDLSIFCSTCLIRKPIRSKHCAVCNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLL
CMICWMMYGCIAYWRVHCATSYAKDGFWLYLTQIASCSPWIFWMFVNSVFHFMWVAVLIM
CQLYQIAALGITTNERMNARRYKHFKVTATSIESPFNHGCIRNLIDFFEIRCCGLMRPVT
VDWTTQYTIEYDQTSGSGYQLV
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgctatggaggaatatgagaaagaagctggctgcgtccctattctccatccc
gaggaaattaaaccccagagtcactacaaccatggctacagcgagaatgtcagccgtaaa
aaccacgtggatgattacagtacctgggacatcgtcaaagccacacagtacggtatcttc
gagcgctgcagggagttggtggaggcgggcttcgatgttcggcagccagacaaagaaaac
gtaacgctcctccactgggccgccatcaacaacaggatagatttggtcaagtactacata
tcaaagggagccatagttgaccagctaggaggagacctcaactccacacctttgcactgg
gccaccagacaaggccatctatccatggtggtgcagctcatgaaatatggcgcagacccg
tctttgatcgatggcgagggctgcagctgtgtccatctggctgcccagttcggtcacact
tctattgtggcctacctcatcgctaaaggacaggatgttgacatgatggatcaaaacggc
atgacgcctctcatgtgggcagcctacaggacacacagtgttgatcccacccgactccta
ctcaccttcaacgtgtctgtcaacctgggcgacaaatatcacaagaacacggcgctgcac
tgggccgtgctggctggaaacaccaccgtcatcagcctgctgctggacgccaacgccaac
gtcgacgcgcagaacatcaagggcgaaacgccgctggacctcgccaagcagaggaagaac
gtttggatgatcaatcacttacaggaagcgcggcaggccaaaggttacgacagcccgtcc
tacctgaaacgactgaagatggacaaggagtttaggcagaaggtgatgctgggaacgccg
ttcgttgtcatctggctcgtcggtttcgtcgccgacctggacatcgactcgtggctcatc
aaaggcatcatgtacgccggcgtctgggtcgccgtgcagttcctctcaaaggcttttttc
gaccactccatgcacagcgctctgcctctgggaatctacatggcaaccaagttttggatg
tacaccacctggttttactggttctggaacgaccttccttttgccactgtccatataccc
ttcctgatcaacagcctggctttgttctacaacttcggcaaatcctggaagtccgacccg
ggaatcattaaagcatccgaggaacagaagaagaagacgattgtggagctggccgagacg
ggcagcctggatttaagcatattctgcagcacctgcttgatacggaagcccattcgctcc
aaacactgcgccgtgtgcaaccgctgcatcgccaagttcgaccaccactgtccgtgggtg
gggaactgcgtgggaagtgggaatcaccgttacttcatgggctatctgttcttcctgctc
tgcatgatctgctggatgatgtacggctgcatcgcctactggagggtgcactgtgccacc
agctacgccaaggatggcttttggctctatctgacccagatcgcctcctgctcgccctgg
atcttctggatgttcgtcaacagcgtgtttcacttcatgtgggtggccgtgctgatcatg
tgtcagctctatcagattgcggcgcttggaatcaccacaaacgagaggatgaacgctcgg
agatacaagcactttaaggtcacagccacgtccatcgagagccccttcaaccacggttgc
atccgaaacctgatcgacttcttcgagatccgctgctgcggcctgatgcggcccgtgacg
gtggactggaccacgcagtacacaatagagtacgaccagacgtccggctcaggctaccag
ctggtgtaa

DBGET integrated database retrieval system