KEGG   Kryptolebias marmoratus (mangrove rivulus): 108245365Help
Entry
108245365         CDS       T05608                                 

Gene name
pla2g4c
Definition
(RefSeq) cytosolic phospholipase A2 gamma
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00564  Glycerophospholipid metabolism
kmr00565  Ether lipid metabolism
kmr00590  Arachidonic acid metabolism
kmr00591  Linoleic acid metabolism
kmr00592  alpha-Linolenic acid metabolism
kmr01100  Metabolic pathways
kmr04010  MAPK signaling pathway
kmr04217  Necroptosis
kmr04270  Vascular smooth muscle contraction
kmr04370  VEGF signaling pathway
kmr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    108245365 (pla2g4c)
   00565 Ether lipid metabolism
    108245365 (pla2g4c)
   00590 Arachidonic acid metabolism
    108245365 (pla2g4c)
   00591 Linoleic acid metabolism
    108245365 (pla2g4c)
   00592 alpha-Linolenic acid metabolism
    108245365 (pla2g4c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108245365 (pla2g4c)
   04370 VEGF signaling pathway
    108245365 (pla2g4c)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    108245365 (pla2g4c)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108245365 (pla2g4c)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    108245365 (pla2g4c)
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     108245365 (pla2g4c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B 2_5_RNA_ligase2
Motif
Other DBs
NCBI-GeneID: 108245365
NCBI-ProteinID: XP_017287716
UniProt: A0A3Q3AVY9
Position
Unknown
AA seq 586 aa AA seqDB search
MEEEWGIFHACPERSIAAQERKYVSSRWFSKRSKMADRKHSKKAIRQSPSLCAGELDYIN
RRKHVVLQALCSKGINCSMDSVPHIALLASGGGQRAAVGLMGSLYQMEKDGLLDTLLYIA
GVSGSTWSMASLYSDPQWSSNMDDAVSRLSSFEVELEQVLAWVGERSKEENFSLSDIWGV
LTTAGIMKQMDVRHLSHEANRDVTNPYPIYCAVEKYCFSNGLFEGKWFELSPHEAGFTEL
GLFVDTSLLGCKFQGGELLEKKPEMDIVWLQGVLGSMLADEETLKESLNDLGHIDDDDAE
KYLHAYKVFNNLISLIRSTLKDPTAMSDLDQLQKALKDKVDWKDTVQLNSKSPEERKSLF
QQLNQELLAEVETWSQSLEDRDFKPHVSFIREQILPLICKWEWGTTNNFLYQYQDSSVPA
CLRAKEQFHLIDAGLLVNVAYPSFLGEKRDIDLIIAPEYSAGNMFETLTLARAYATKAMK
PFPEIDDKILEDRDWPKDCYVFEGKDKEPTIIYMPLFNQQNCKDAEEFKAKMEEFTTLQR
PYSQEKIVVLLETVKSNIRNNRETLLREINNAVIRQKNKRPEQDGL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagagtgggggattttccatgcttgtcctgaacgcagcatagcagcgcaggag
cgtaaatacgtcagcagccgctggttcagtaaacgaagtaaaatggccgatagaaaacac
tccaagaaagccatccgtcagtccccgtctctgtgtgctggggagctggactacattaac
agaaggaagcatgtagttctgcaggcactctgcagcaagggcatcaactgttcaatggat
tctgttccccacattgccttgttggcatctggtgggggtcagagggcagcggtaggtctg
atgggttccctttatcagatggaaaaggacggtctcctggacactttgctctacatagca
ggagtttctggatcaacatggtctatggcatctctgtacagtgacccccagtggagctct
aacatggatgatgctgtttccagactgtctagttttgaggttgagctagaacaggttctg
gcctgggtgggtgaacgatctaaagaagaaaatttctctcttagtgacatctggggggtc
ctaaccactgctgggatcatgaaacagatggatgtacggcacctttcccatgaggccaac
agggatgtcaccaacccttatcccatctactgtgctgtagagaagtattgcttctcaaat
gggctattcgaagggaaatggtttgagttgagcccccatgaagcaggattcacagagtta
ggcctctttgttgatacttctctcctgggttgcaagtttcagggaggagagctgctggag
aagaaaccagagatggacattgtctggctccaaggtgttttaggcagcatgttggctgat
gaggagacactcaaagagagtctgaatgaccttggacacatcgatgatgatgatgctgag
aagtatctgcacgcatacaaggtctttaataacctgatatctctgatcagaagcacccta
aaggatcctacagcaatgtctgatttggaccaactgcaaaaagcactaaaagacaaggta
gattggaaagacactgtgcagctgaattccaaaagtccagaggaaagaaaaagtctgttc
cagcagctgaaccaggagctgctggcagaagtcgagacttggagccaaagtctggaggac
agagacttcaaaccacatgtttcttttattagagagcaaatccttcctcttatatgcaaa
tgggaatggggaacaaccaacaacttcctctaccaataccaagattcctcagttccagct
tgtctccgagctaaagaacagtttcacctgatagatgctgggttgttggtcaacgtggcc
tacccttcatttctgggggagaagagagacattgacctgatcattgcaccagagtacagc
gctggaaacatgtttgagactctaactcttgcacgagcctacgcaacaaaggcaatgaag
cctttcccagagattgatgacaaaatactggaggacagagactggccaaaggactgctac
gtctttgaggggaaagacaaggagccaaccattatctacatgccactcttcaaccaacaa
aactgcaaagatgcagaggagtttaaagcaaagatggaggagttcaccaccttacaacgt
ccctacagccaggaaaagattgttgttttgttggagacagtaaaatctaacatcaggaac
aacagggagactctgctgagagaaataaacaacgctgtgatccgccaaaagaacaagaga
cctgagcaagatgggctgtaa

DBGET integrated database retrieval system