KEGG   Kryptolebias marmoratus (mangrove rivulus): 108246271Help
Entry
108246271         CDS       T05608                                 

Definition
(RefSeq) band 3 anion exchange protein-like
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kmr02000]
    108246271
   04147 Exosome [BR:kmr04147]
    108246271
   04090 CD molecules [BR:kmr04090]
    108246271
Transporters [BR:kmr02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   108246271
Exosome [BR:kmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108246271
CD molecules [BR:kmr04090]
 Proteins
  108246271
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto PTS_EIIA_2 RVP_2
Motif
Other DBs
NCBI-GeneID: 108246271
NCBI-ProteinID: XP_017289226
UniProt: A0A3Q3BPK4
Position
Unknown
AA seq 841 aa AA seqDB search
MKDQEQPAYWQEMGRWAGYEESFDPQAGVWASSQISYLTFRSLIQLRRTMNTVVTIFDCE
EKTLSDIAEKMVAEMVNKKEIRSGDREGVLKSLVQNRSESSDPESQKLTDGVDLHKFSVK
ERMDESDHVEASMVLVGALDFLEKPTIAFVRLKEAATLDSALEAPEPVRFVLVLIGPSKT
DMDYHEMGRAMAALMADKVFNQAALEAKSARELTDALVKFIDCSIIIPPTEIKNEAMLSS
IINFQKKLLKDRLQSSEIMPRRNSTTRRVSISSGSPAEDPLARTGRLFGGMIRDVKRRYQ
YYRSDLTDALNAQALAAIIFIYFAALSPAITFGGLLADKVDNMMGVPELLISTSIQGIIF
CFVAAQPILVIGFSGPLLVFEEAFFAFCKSQDIEYIVGRVWVGVWLVIIVVIIVAFEGSF
LVRYISRFTQEIFSILISIIFIYETFAKLGRTFKAHPLILNYDHLNATIENPWNPRVEED
FIYDNATGNITFVVNTIKPPYPNTALLSMCLMFGCFFIAFFLRQFKNGTFLPGKVRRLLG
DFGVPIAIFLMIVADYNIEDTYTQKLVVPKGLMVSNPAKRGWLINPFGEHKSFPVWLMFA
SCIPALLVFILIFLESQITTLIISKPERKMVKGSGFHFDLLILVGMGGLSAIFGMPWLSA
ATVRSVTHANALTVMSKGPKPVIERVLEQRISGIVVALLVGLSILMEPILKLIPMSALFG
IFLYMGVTSLNGIQLWDRMLLLLIPKKYHPDEPYATRVSTGRMHLFTAIQMVCLALLWIV
KSSPVSLALPFVLILTIPLRMLMTGRLFSELEMKCLDADDAKVTFEEEPGQDVYCESQMP
L
NT seq 2526 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaccaggagcagccggcgtactggcaggagatgggccgatgggcaggctacgag
gagagcttcgacccacaggccggggtgtgggcatcctcacagatctcctacctcacattc
aggagcctcatccagctgcgccgcaccatgaacactgttgtaaccattttcgactgtgag
gagaagactctctctgacatcgctgagaagatggtcgctgagatggttaataagaaggag
atcaggtctggagaccgggaaggtgtgctgaaatctctggtccaaaaccgcagtgaatca
tcagatccagaaagccagaaactgactgatggcgtggacctgcacaagttttcagtcaaa
gaaagaatggatgaaagcgatcacgtcgaggcctcaatggtgctcgtaggagccttggac
tttctggagaaacccacaattgcttttgtgcgtctgaaggaagcggcgacgctcgactca
gccctggaggccccggagcctgttcgctttgttttggttctgattggccccagcaagact
gacatggactaccacgagatgggccgagctatggctgctctgatggctgataaagtgttt
aaccaggcagcattagaagcaaagagcgccagagagctgaccgatgccttggtcaaattc
atcgactgcagcatcatcatcccacccaccgaaatcaagaacgaagccatgctgagctcc
atcatcaactttcagaagaaactcctgaaggacaggctgcagtcgtcagagatcatgccc
cgcaggaactccacaacacgtagagtttctatttccagcggctctcctgctgaagacccc
cttgctcgcaccggtcgactattcgggggcatgattcgagatgtcaagaggcgctaccag
tactacaggagtgacctcacagacgccctgaacgcccaggctctcgctgccatcatcttc
atatactttgctgccttgtcacctgccatcacttttgggggcctgctagctgataaggtg
gacaacatgatgggtgtaccggagctcctgatctccaccagcatccaggggatcatcttc
tgtttcgtcgctgctcagcccatcctggttatcggtttctctggtcctcttttagtgttt
gaggaggccttctttgcattctgcaagtcccaggacattgaatacattgtgggtcgggtg
tgggtcggggtgtggctcgtcatcatcgtggtgatcatcgtggcctttgaaggcagcttc
ctggtgcgctacatctcacgcttcacccaggagatcttctccatcctcatctccatcatc
ttcatttatgaaacttttgccaaattaggaaggaccttcaaggcccatccactgatcctg
aattacgatcacctgaatgcaacaattgaaaatccctggaatccaagggtggaagaggac
ttcatctacgacaacgccactggcaacataaccttcgttgtcaacactatcaaaccgccc
taccccaatacggccctgctctccatgtgtctaatgtttggctgtttctttattgctttc
ttcctacggcagtttaaaaatgggacatttcttcctggaaaggtcaggcgcttgcttggt
gactttggcgtgcctattgccattttcctcatgattgtggcggactacaacattgaggat
acctacactcagaaactggttgttcctaaagggctgatggtatccaacccagccaaaaga
ggctggctcatcaacccctttggagagcacaagtctttccccgtgtggttgatgtttgca
tcctgcatcccagccttactcgtcttcatcctcatcttcctggagtctcagatcacaacg
ctgatcatcagcaaacccgagaggaagatggtgaaaggttctgggtttcactttgatttg
ctgattctagttggaatgggggggctcagtgccatatttggtatgccgtggctcagcgct
gctacggtccgatctgtcacccacgccaacgctctcacagtcatgagcaaaggaccaaaa
cctgtgatcgagagagtgctggagcagaggatcagcggcattgtggtagccttgcttgtt
ggtctgtcaattctgatggagccgatcttgaagctgattcccatgtcagccttgttcggg
atcttcctctacatgggagtcacgtcactaaacggcatccagctgtgggatcgtatgctg
ctgcttctcattcctaagaaatatcaccctgatgagccatatgccaccagagtgagcaca
gggcggatgcacttgtttacagcgatccagatggtgtgtcttgcactcttgtggattgtg
aaatccagccccgtgtccctggcgcttccctttgttctcatcctcaccatccctctgcgc
atgttgatgaccggccgtctcttctccgagctggagatgaaatgtttggatgctgacgat
gccaaagtgacgtttgaggaggagcctgggcaggacgtgtactgtgaaagtcagatgcct
ttgtag

DBGET integrated database retrieval system