KEGG   Kryptolebias marmoratus (mangrove rivulus): 108246374Help
Entry
108246374         CDS       T05608                                 

Definition
(RefSeq) venom phosphodiesterase 1-like
  KO
K01513  ectonucleotide pyrophosphatase/phosphodiesterase family member 1/3 [EC:3.1.4.1 3.6.1.9]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00230  Purine metabolism
kmr00240  Pyrimidine metabolism
kmr00500  Starch and sucrose metabolism
kmr00740  Riboflavin metabolism
kmr00760  Nicotinate and nicotinamide metabolism
kmr00770  Pantothenate and CoA biosynthesis
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    108246374
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108246374
   00240 Pyrimidine metabolism
    108246374
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    108246374
   00760 Nicotinate and nicotinamide metabolism
    108246374
   00770 Pantothenate and CoA biosynthesis
    108246374
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:kmr04090]
    108246374
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kmr00537]
    108246374
Enzymes [BR:kmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.1  phosphodiesterase I
     108246374
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.9  nucleotide diphosphatase
     108246374
CD molecules [BR:kmr04090]
 Proteins
  108246374
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:kmr00537]
 Enzymes
  108246374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Somatomedin_B Endonuclease_NS Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 108246374
NCBI-ProteinID: XP_017289369
Position
Unknown
AA seq 866 aa AA seqDB search
MDWLKQVQRNKKILIGVLAVVIVTLILGLGLGLGLELQRCKDKVIPQTSCRNRCYEPFDD
EVAGCRCDKNCVLSKSCCHDYYDICTLPTEQWECTKLRCGEKRLTESKCHCSEDCLQAGD
CCTNYKHVCHEEKEWVEDTCEDLSTPKCPERFKRQPLLLVSLDGLRAEYMQSWSMLIPVL
DKLRSCGTSAPFMQAAFPSKTFPNHYTIVTGLYPESNGLIDNNMYDPVFDASFSLSSPEK
NNPAWYLGQPVWHTASYHGLKSGTFFWPGSDVKINGSFPDIYKPYNGKVPFEERVFTVLK
WLQLPDNERPDFYTLYLEEPDKSGHSFGPVSGGIISSIQAVDKIMGQLMNGLKQIDLHRC
LNIIIVADHGMEETSCDRKEAMQELVGDTSNYVVNEGPVGRIRAKNKNTILDSEGLVANM
SCKKPDQKIKPYLKANLPKRLHFANSRRIEDVNVLVETKWLFERDPGSLTFCSGGNHGYD
NDVESMHALYLSYGPKFQQKTTIEPFSNIELYNVMCDVLEISPVDNNGTHGSMNHILKKP
YYTPKFPEEESRPTQCPLVSLDPTDNLGCSCPALTGNVINSRLNLTAEEILTAEKKHMLF
GRPQMLQPDQSYCILHHEGFVNAYGHKVFMPLWSSFTIAKPTNLDPLPPVTPDCLRADVR
LPAPQSPRCDEYDVAGNWTQAFLYPPNLNVTTDQQYDALLMSNVVPMYPEFRKIWDYFHN
TLLKKYASVYNGINVVTGPVFDYNFDGQYDTQEQIQQFVPGTNISIPTHYFVVLTSCKDS
GQPVSTCMDQLQTVSFLLPHRADNTESCKSAEDESHWVEDHIWFHQSRVRDVEWVTGLDF
YQGSIRPVPELLMLKARPTAAIQRKQ
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atggattggttaaaacaggtgcagaggaacaagaaaatccttattggtgtcttggctgtg
gtgattgtaaccttaatccttggtcttggtcttggacttggactggaattgcagagatgt
aaagataaagtcatcccccaaacttcctgcaggaacagatgttacgagcccttcgatgac
gaggtcgcgggctgcagatgtgacaagaactgcgttctttcaaagagctgctgtcatgac
tattatgacatttgtacccttcccactgagcagtgggaatgcacaaagctgcgctgtggt
gagaagaggctgacggagagcaaatgtcactgctctgaagactgcctgcaggcaggagac
tgctgcacaaactacaaacatgtctgccatgaagagaaggagtgggtggaggacacctgt
gaggacctgtcaacccccaaatgtccagaaaggtttaagcgtcagccacttctgcttgtg
tctctggatggactgagggctgagtacatgcagtcatggagcatgctcatccctgttctg
gacaaactcagaagctgtggaacgtcagctccattcatgcaggcagcatttccaagcaag
acttttccaaatcactacacaattgttacgggtctgtatccagagtccaatggcttgatt
gacaacaatatgtatgatccagtgtttgatgctagcttcagcttgtccagtcctgagaaa
aacaaccctgcctggtacctcggacaacctgtttggcacacagcgagttaccatggtctg
aagtctgggactttcttctggcctggatcagacgtcaaaatcaacggaagttttcctgac
atctacaaaccttacaatggtaaagtgccatttgaagaaagagtatttactgtcctgaag
tggctgcagctgcctgataatgaaagaccagatttctacacattgtatttggaggaacct
gataaatctgggcatagttttggtcctgtcagcggagggattatttcatccattcaggct
gtggataagataatgggtcagctcatgaatggcctgaagcagattgacctgcatcgctgc
ctgaacatcattattgttgctgatcatggtatggaagaaactagctgtgacaggaaggag
gcgatgcaagaactggtgggagataccagcaattatgttgtcaatgaggggccagttgga
cgcatccgagccaagaataaaaacaccatcttggactcagaaggactcgttgccaacatg
tcatgcaagaagccggaccaaaagatcaagccatacctgaaggccaacctgccgaagcgc
cttcactttgccaacagtcgtcgcatcgaagacgtcaacgttctggttgaaacaaaatgg
ctgtttgagagagatccaggatctctcacattctgctctggtgggaatcatggctatgac
aatgatgtggagagcatgcatgccttatatctcagctatggccccaagtttcagcaaaaa
acaaccattgaacctttctctaacattgagctgtacaatgtcatgtgtgatgtgctggaa
atctctcctgttgataacaatgggacccatggcagcatgaaccacatcctgaagaagcct
tactacacaccaaagttcccagaagaggagagcaggccaactcagtgtccactggtcagc
ctcgatcctacagacaacttgggatgctcctgcccggccctgactggaaatgtcatcaac
agccgtttgaatctgacagcggaggagatattgactgcggagaagaagcacatgctgttt
ggtcgtccccaaatgctgcagcctgatcagagttactgcatcctccaccacgagggattt
gtcaacgcctacggccataaagtcttcatgcctctgtggagctcattcaccattgcaaag
cctaccaatttagatccactgccaccagtgacaccagactgtttgagggctgacgtgaga
ttgccggctcctcagagtcctagatgtgatgagtatgatgttgctgggaactggacccag
gcctttttatatccacccaatctgaatgtgacaacagaccagcagtatgatgctttactc
atgagtaatgtggtcccaatgtaccctgagtttagaaagatctgggattatttccacaac
actttgctaaaaaaatatgcctctgtatacaatggcattaatgtggtgactggtcctgtc
tttgattacaactttgatggccaatatgacactcaagagcaaatacaacagtttgtgcct
ggaacaaacatttccattcccacccattactttgttgtgttgaccagctgcaaagactcg
ggtcaaccagtcagcacttgcatggatcagcttcagacagtgtccttccttcttccccac
agagccgataacacagaaagctgcaaaagtgcagaagatgaatcacattgggtggaggat
cacatttggttccatcagtcacgagttagagatgttgaatgggttacaggactggacttt
taccaaggcagcatcagaccagttccagagctactgatgctgaaggcccgccctacagct
gctattcaaagaaagcaataa

DBGET integrated database retrieval system