KEGG   Kryptolebias marmoratus (mangrove rivulus): 108247201Help
Entry
108247201         CDS       T05608                                 

Gene name
cacng5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04010  MAPK signaling pathway
kmr04260  Cardiac muscle contraction
kmr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    108247201 (cacng5)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    108247201 (cacng5)
   04261 Adrenergic signaling in cardiomyocytes
    108247201 (cacng5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:kmr04040]
    108247201 (cacng5)
Ion channels [BR:kmr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   108247201 (cacng5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 DUF716 DUF4199
Motif
Other DBs
NCBI-GeneID: 108247201
NCBI-ProteinID: XP_017290636
UniProt: A0A3Q3BEN7
Position
Unknown
AA seq 277 aa AA seqDB search
MSLCGRKVLTLLSSVFAVCALGLLGIAVSTDYWLYLEEGVILPLNQSTEMRMSLHSGLWR
VCFLAGEEKGRCFTIEYVMPTTVQMTSESTVSVLKMIRSSTPFPLVSLFFMFIGFVLSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISNINDEMLNRTKTNEAYFSYKYGWSFA
FAAISFLLTETAGVMSVYLFMKRYTAEEMYRPHQGFYRPRLSNCSDYSGQFLHPDAWAGR
GRSPSSISSEASLQMNSSNYPALLKCPEYEQMSSSPC
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgagcctatgtggcaggaaggtgctgacgttgctgagcagcgtattcgctgtctgcgcc
ctcggcctgttggggatagccgtcagcaccgactactggctctaccttgaggaaggagtc
atcctgcccctcaaccagagcaccgagatgcgcatgtccctccactccgggctctggagg
gtttgcttcctggctggggaggaaaaaggaagatgttttaccattgaatatgtgatgccc
actactgtgcagatgacatctgagtccactgtcagtgtactcaagatgattcgttcttcg
acgccctttcctctggtcagcctcttcttcatgttcattggttttgtgctcagtaacatc
ggccatattcgaccacatcgcaccatcctggcctttgtttctggaatcttcttcatcctt
tcaggtctctctctggttgtcggtctggttttgtacatctccaacattaatgacgaaatg
ctgaacaggaccaaaactaacgaggcctacttcagctacaagtacggctggtcgtttgcc
tttgctgctatctctttcctgctcacggagactgcaggtgtcatgtcagtgtatctgttc
atgaagcgctacactgcagaggaaatgtacagacctcatcagggcttctaccggcctcgc
ctcagcaactgctcagattactcgggccagtttctccacccggacgcctgggctggacgc
ggtcgcagcccctcctccatctcctctgaggcctccctccagatgaactcctccaactac
cctgcccttctcaagtgtccagagtatgaacagatgtcctcctcgccctgctga

DBGET integrated database retrieval system