KEGG   Kryptolebias marmoratus (mangrove rivulus): 108247752Help
Entry
108247752         CDS       T05608                                 

Definition
(RefSeq) titin-like isoform X1
  KO
K12567  titin [EC:2.7.11.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108247752
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:kmr04131]
    108247752
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:kmr04812]
    108247752
   04147 Exosome [BR:kmr04147]
    108247752
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108247752
Protein kinases [BR:kmr01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   108247752
Membrane trafficking [BR:kmr04131]
 Others
  Actin-binding proteins
   Others
    108247752
Cytoskeleton proteins [BR:kmr04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     108247752
Exosome [BR:kmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   108247752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 Ig_2 ig V-set Pur_ac_phosph_N fn3_2 C2-set_2 Receptor_2B4 Tissue_fac Pkinase fn3_4 Ig_6 C1-set Pkinase_Tyr Izumo-Ig Ig_5 THB Ig_4
Motif
Other DBs
NCBI-GeneID: 108247752
NCBI-ProteinID: XP_024866328
Position
Unknown
AA seq 26542 aa AA seqDB search
MPRPEVSWFHNRQPVRPTKNVVFHFDEETNVATLIIVDAFSEHAGQYSCRAANNAGEAMC
SATLTITREEEGVTHVREQIETTMEQEVKVPPVFKQKINPVDINVGDHAKFDCETEDAPN
VTFKWNKSGIEIRQSDKYRIVSHPTGSSLEILNPVKADSGDYTCKASNQHGSDSCSASLV
VTEMYPPVFVSKPDPMTLFVGKQAVLQCSLTGSSPMEVVWHKDNVVISSEGNYVIKCEKN
KYSLHIKSLELTDQGVYLCKASNSVGTATFTTELRVINKPSFVKPFESVSAAVNDPLRLE
CQVDEDTGVTVTWTRDGKKVHQSMDCKLSFEDKVAVLEIPKSKQKDSGKYVCTAANEAGS
SSCEAVVTVQEPPAFVRKMEPKITWKQGAPARLQCTVKGSPELHIHWFWNDRELSDGDKY
KLTFKNGVASVEILNLLVTDSGTYTCEVSNNAGSESCSTFIAVKEPPTIRKDLQTLEAVK
GAAAHLECEIAGTAPFEISWLKNKKPLTSDQKFRIISQDSLSRLEIQTFESADVGDYQCV
ISNDVGKVTTKALAKLKEPPSFSKRVESVTAVLGNSVKLQGTIKGSSPITVKWKKDSEIL
RDDDPNIRMVFENNVAILSIAAVAISHGGKYSCQAENEAGQQKCEATLTVQEPARIVEPA
ESISVTAGDSATLECTISGSPELKVKWFKDGKEMISGRKYKMTLKENVATMKILTAEKGD
TSEYKMEVSNKVGKAQCTCSVTVLDRIMPPTFTKSLKRVDGNIGNDISMDCKVSGSQPMT
ISWFKDDQEIESGAKFQPEFKDSSATLRISRLEKTDSGVYKCRASNSAGFKETSGTLYVK
EPPVFTEKPDNQDVIPGAKVSFRATFTGTAPLAIKWFKEEKEIVTGGIYFIKKDASSSSL
ELHSVKPSDSSKYTCQVSNDAGKVDCTAVLFVKEPPVFVRKLDATKLVTSGDSTRLECRV
TGSPVISFKWFKDEMEISSSPKYSISLTDVEATLEILNCSVEDSGDYVCVASSEAGSDRC
SSTVTVKEPPVFIRSLESKDVVKGSEMILECQVSGSAPFTVSFYKNSKVIRNDRRHRITV
KEDLLALQVLAVEAGDVGLYQCTVENEVGRSSCECQVTLKEPPSFVKKLENLSPLVSSDV
SLQCSLKGSEPIVVTWLKDNHELKEAENVHISYESRTAVLLISSLQSQHGGKYSCQAQNQ
AGSQTCSAVLTVKEPAKITEEVKSISVTQGDPATMEARFSGTKPLKAKWLKAGKELTSGQ
RFKIQSKDTSSVLKIIKTEKSDSGEFTFEVSNDVGQSSCEATLTVLDQVIPPSFTRKLKQ
TEGIKGSFAQLECLVAGSLPITVQWFKDEKEIQADEKHKCTFFENVACLEISDLNIKDGG
SYTCIAKNKAGTVQCSGILLVKEPPFILEKPESMNVLPGSKVQFNVLVSGTPPLTIKWFK
NKKEILSSADCSVVKDNTSTTLELFFAKISDSGDYVCEIQNDVGSTSCQAALFVKEPPKF
TRTPARVSVVRPGQSKVFECQVTGTPEIDIYWFKEGSELSASDRYKMTFVNSVATLEVCG
ADTKDGGLYYCEARNEAGSESCSMELKVNEPPSFIKELCAADAVKGSNACFECQVAGTSP
FEIMWHKDGKEIKPSAKHGFSQMNDTLSLEVHKCDAVDVGEYQCTVANEVGSCTCKTTLS
LKDPPTFTKRIENSVTVLGKMAEFQCVVVGSPTLSVQWQKDENWILEDPKIERTFENNVA
TLKIPACEATHGGKYTCQVINEAGQDKCFASLTVQEPPQILEKPEEIKVTVGDPVSLDCK
VKGSPELKVRWMKDGRELQSIRQHKLIFENNISSLKIQAAQRADEGEYVFEVSNHISSCS
CKVKVVVLEQVIAPSFIKPLIDMQEILGSFVQICCKISGSLPISVEWQKDGSKISSGVKH
KLIQQDNSVSLEMEQLEISDAGSYSCKLTNAAGSCECSGSLMVKVPPSFVTLPESQVALP
NATVRFKSTFKGTPPFTVKWFKEDTELMTGPSCFTGVDETSCFLELYSVAVTQTGVYSCQ
VSNDAGSVRCSADLTVKEPPEFVLKLPATKFVKRGESLRLECKVSGSAPLKMTWYKHDTK
VSEEGNCRTSFVDSVAVLELLSSSFDDDGVYTCEAQNDAGSVSCSTTLTVKDPPSFVKVP
QPIEGLKGKDVSLYCEMSGSAPFQVTWFKDRKPLMESRKYKVVSEGSSATLHVIGIEAAD
AGEYECKVSNSVGSDSCNTSVKLREPPSFVKKLSNMTVILGEEVTLMATVKGSEPITVSW
VQDKDHILRDSDNRKITFENNQVTLKVFKADATTAGKYTCQLRNDAGTVECFANLTVIEP
AKIVDKPDALSVTAGDIAALEVKVCGTPELVPKWFKDGVELASGRKYKISFSRMISSLNV
VNAEKLDSGEYTFEVMNQVGKDLSKINLTVLDKIVPPTFTRKLKDCKMVVGEATEMECKV
SGSPPFTISWYHDGEEIQSGPNHEVSFSDNSCTLRVPTLKLSDSGVYKCKAVNKAGSTET
SASLAVKEPPSFVVPLQPVEAMPGSNVTFSAIVKGSTPLKLKWFRGTKEILPGKDCTFSL
KDNQVTLELFNVNRSHTGEYTCQVINDAGKESCAVNLSVKEPAAFSKKLKDVSVEKGRPL
TLECSYTGTPKITVSWFKDGQQIFASYKYNITTTESSCILECLSTDDKEAAGTYCCQVSN
DAGKDTSEAVVSILEPPYFVESLEPMEVTAGDAVCLKCQVAGTPEIKVSWFKADGKVRSS
PTCKLEYSKGVACLKLSKATKADIGEYTCKAENKIGSSSSTCRLNVLEAKTPPSFPKKIT
SLQETEGQAVRFECRVAGSSPIEVSWLKDGEPLTEGGEFSMMYDDNTAVLQIGCGEMRHS
GEYTCVATNSVGSASCRAKLTMQEPRYAPVFDRKLSPLEVTVGDSIELECHMTGSAPIKV
TWSKDHKDIRSGGNYKLSCVDNTPHLSILKADKADTGKYFCHVSNDMGKDSCSADITVKE
RKNPPVFTKKPSEHIEDTEGKLVKIEGRVTGSQPMSVSWFKDDKEILLSDKYDISFKSNV
AVLCIKSSQVSDSGRYSCQASNEAGRTSCDVTVGILEAKKPPVFDVPLKPVTVDEGDRLS
LRCHVCGSPPLKIQWMKDRRELTSAGSTRISFSEGTACVEISSVSKHDAGDYLCKATNEA
GSEFSKAKITVREKPGAAPPPAEAPAAAPTKKLENLFFIEEPKAAHVTEKGTATFIAKVG
GDPIPSVKWMKGKWRQLTHGGRISIEQKGQEAKLEIKEVTKSDSGQYRCVASNKHGEIEC
SADMHVGDKKVAPQLEGDLRAKLKKTPSKQKSPQEEKDIDIVELLRNVDPKEYEKYARMY
GITDYRGLLQAIEQLKKEKAEESGRPEMERGDRESDEDMARLVADLQKRMERTEPVTVVT
DISNQSVFTHEDAEFKCELKINYPEITLSWYKGTQKLDTGDKYHISISDDLHLLKIKRCQ
PSDQGNYRVVCGPHISSAKLTVTEVEVEKHLQDTSGKEGQPCTLSCQLSVPNVQAQWFKN
DLQLEMKGRYSSEVKHKVQKLLIRDLKPEDQGRYSCRYRHLESSAELRVEAEQIHFTKRI
HNIEVHELQSATFECEVSFDNAIVSWYKDTWELKESIKYNFRSEGRRHFMVIRNVTIEDE
GVYSVIVRLEPRGEAKSTAELYLSAKEIELAMVPTDFPDSSVLRPEVPSSVEIQESTEFY
QFEEKMEHRESAEYSYQYEEEVQQKVEVQSWTEETITQQVSEIQAARVAVEEKVETKTVE
LREELPTKVEKKLKEKPAAAVEEPTPHRELEVREPVEEKVPVVSVPEKKEAPAPKEPETV
KKPFFAPPPPAEKTQLPTKDEPKPQVPAEPKKVVPQAEPKVEPEPKPKPAAPPKAEPEPK
PKPAAPPKAEPEPKPKPAPPPKAEPEPKPKPAPAPKAEPEPKPKPTAAPKAEPEVTPVAP
PSKAPKEAPKTKPEPAVTKPQPEAPKPKVEPEKTKPEVRKPEPPITKPEPSVQKPEPAPV
LKEPERKVPEEPKKKVVAPPPPPPPPPPPPVPQKVQKEAEEPKKKPVKVPVEEKVPEPPK
AKKAERGEVPPKEEPAPKDKALKPKQKPEEMPQKVPLKVSEEVVVLETKPEPEPARKPAG
KPEVKEKPPERIPDKVVTPEKKQEVTVKIPEKLQDKVEEKVPPQRKPDKIPQKEAEEKKK
PAEKVPVKPEEVKLEKKQPEKISVAEKVSVKTPEKVEAKRASEEPASKETEVQKIEKIRP
KDQETIVSAPEEVPKKDKETPPQVKETKPAAPKEEAKPKAAVKVPEAAKRPEVPEKQTAP
QEVTMPVTKPQPAVKAEEPPKVAPEEKKPAVVEKISPVTDETKGPVQAPGGVQKEGQPAE
EAGRGRGRGLKPKQTPSPGEGRGRGLRPGGRGPTPPEEPFAGFKLKAVPLKFIKKLQDIV
LQEAESIGSSAVFECEVSPSTAITSWMKDGGNLRESPKHKFTSDGKDRKLHIIDVQLSDT
GEYTCVAKNAGKEITCTAKLIVEELPVKWIKELEEETSAIKGQPIYMTCELNKERDVVWK
KNGEVLKKKEGKIQINIIGMQHAVTIQNSTEEDAGCYSCEVSGQEDVKTSTNVKVMEIIK
DWIVKPLKDQHVKPKATAVFKCELFRDTPNWKWLKGENEVIPSDKVEIEMDGKVLTLTIK
NCQPNDVAEYSMEVEGRVYTAKLTLGEREAQILKPLASVEVVEKQDAMFETEISEDDVPG
EWKLKGEVLIRSPTCDIQMDGTVRRLTLKNCQLDQAGEVSYQALNAITTAMLNVREIEMD
FVVPLKDVCVPEKKQAKFECTITKDVAKVMWYKGADIITPDQKYDIIDDGKKHMLVINCC
EFDDEDEYTIEVLGKTSTARLTVEGIRLKFISPLKDQTVKEGQTARFELEFSHDNIPVTW
YKNDVKIHPSRTVITHVDGKKHVLEIKDVTLDDICQIKAEAKGIPSMANLTVIEGDPYFT
VKLQDYTAVEKDNVVLDCELSKDVEVMWYHNEAEIKATKTVAVKAEGKRRTLVIRKVGDK
DKGQYVCDCGTDKTTAKLHIEARHIKVVRPMYGAEVLEGETARFEVELSEDDVHGQWKLN
GEVLNSSAEVEIVEDGAKHTLVLYNCKVPQTGELVFTAANAKCSANLKVKELPVSFITPL
ADVHVYEKDEARFELEISREPKSFRWLKGTQELLNDDKFEIQVDGNRHTLIVKSARYEDE
AKYMFEAEDKRTSGKLVIKGVRLEFIKPIKDVTVKERETAEFSVELSHEKIPVVWFSNDV
RLHPSKVVHMSEEGKVHMLAFKEVTIDDTSMIKVEAMGKTSEAMLTVLEGDLYFTVKLQN
YTAVEKDEVVLSCELSKAGAEVKWFKDGNEIFPSRNVLFQSDGRKHMLVIKRAAKKDMGV
YACNCGTDKTTADLNIEERDIKVTRPLYSVEVTETETATFETEISEDDLHAIWKLKGETL
HPSADVEIKGEGARHTLTLYNCKMDMAGSVDFSAANAKSTAQLRVKARVIGLMRPLKDVT
VTAGETATFECELSYEGIAVEWFLGGTKLEPSDRVVLKADGKVHSVTVRDVQLNEAGQVK
LTAKDFQTEASLFVKEPPVEFTKPLEDQTVEEESTATLECEVSRENAEVQWFRDGQDIRK
TKKYEMIVDGRKRALLIHECTLDDSRTYTCDAKDFKTSCFLNVEPPHVEFSKPLHDVEVR
EKESARFECEVSREDVKVRWFKDGSEIRKGKKYEIIAQGRQHILIIHKSVFDDEAEYECD
AKTSKSSGMLTVVEEEARFTKNLSNVEGTETDSVRLICEVSKPSADVIWYRGDEELPEGG
RYDQIVDGKRRILLIQDLKTSDAGEYNCRLSPTVRTSGNLQINEMAAEFISRPQNQEVVE
GQKAEFTCSVSKETFEVKWMKDNKELEAGDKYQMVSDGKKRTLVIKDCELKDEGGYVVVI
GATRASADLTVHEKLKIITPLKDTEGKEGQEVVLNCEVNTDGAKAKWLKNEETLFESGKY
TMVQRDNVFSLRIKDAQKGDEANYSINLTNQRGEQAKSSCSLTVKEESLRIVIPLEDIDT
QEKKTISFSCKVNRPNATLKWMKAGEEIALSKRFVYRVDKEKHTLTIKDCTLADEGEYTA
VAGDNKSTAELIISEAPTDFSMNLKDQTITEFDDAEFTCKLTKEKADVKWYRNGREIREG
PRYTFEKDGKFCTLRIKECRPDDECEYACGVDEKRSRARLFVEETPVEIVRPPQDVFEPP
GSDVLFEVELNKDRVEVKWLRNNMTIVQGDKFQMVSEGKVHRLQVCEIRPRDQGEYRVVA
KDKDAKAKLELAAVPQIKTTDQSYVTDAGKPIVMAVPYSAYPRADADWLYDNQSLSKDQI
HTSADRTEYRLKDPKKSDEGRYKITIKNKHGEGEAFIHLSVIDVPGPVKNLQVIDTADGE
VSLAWEEPENDGGSKVIGYVVERRDVKRKTWTLATDHAESPEYTVTGLQKDSFYLFRVCA
RNRVGSGPLVETDKAVQAKNKFDVPEAPLNVIVGNVSKFGCTVSWEPPESDGGSPIISYI
VELRDRTSVKWSPVQVTKADELSAIINDVIENKEYIFRVKAENKAGEGKPSAASQPVKIM
DPIERPSPPLNLTWQDQNKSSVQLSWETPLKNGGSMITGYIIERCEDGTDKWLRCNARLC
PDLFYKVSGLKYGTKYNYRVFAENAAGISDPSNTIGPLLADDPHVGPTFDLSAFKDGLEV
IVPQPLVIRVPISGYPTPVAKWTFGEKELSTADERVCLMTKSTFTELSIAPSVRPDKGIY
TLQLENDVTTVSGEIEVNVIAAPSAPKDFKVLEVTRQHVHLSWEAPEHDGGSPLTGYQVE
KRDVSRKTWVKVVTGIQDQEFTVTDVVEGKEYLFRVTALNKCGPGEPAYIDEPVNVSSPA
TVPDPPENLKWRDKSASGIFLTWEPPKYDGGTGIRGYNVERCQRGTDKWEPCGDMVPELK
CQVTGLIEGQWYAYRVRALNRLGASRPCKATDEIQAVDPKEAPQIHLDAKLLAGLTAKAG
SKIELPAEVTGKPEPKVKWTKADLVLKTDDRVSIDTKPGHSTVTVAKTKRDDSSTYIIEA
TNSSGRATATVDVNILDKPGPPAAFDISDITNETCFLAWNPPRDDGGSRVTNYIVERRAV
DSEIWHRLSSTIKQTTYKAVGLVKFKEYIFRVFAENQFGVGPPAEHPSIIARYPFDTPGA
PYKLEPSDIAKDSLTLTWYEPEEDGGSPITGYWVERYEPDHDRWLRCNKLPIKDTNYRVK
GLPTRKKYKFRVLAENLAGTGKPSKETDPILVKDPIDPPWPPGKPTVKDVAKTSCFLMWT
KPEHDGGAKIDSYIIEMLKSGTTDWIRVAENINFLEFFLKGLMEKQEYSFRVRAVNVAGE
SEPSEPSDPVLCKERLNPPSAPRWLEVVSISRNSAELKWTAPERDGGSKVTNYVVEKRDV
RRKGWQAVDTTVKELKTTVTPLNDGSLYVFRVAAENAVGVGPFCELEDSVLAKDTFTTPG
PPYALTVNTVTKKYVDLEWEAPKNDGGRPILRYSIEKKEKLGTRWVKCAKTSGPDCKYRV
TDVIEGTEVQFQVRAENEAGVGHPCEPTEILTIEDPTGIPSPPIELHVTGASRDFLSIAW
KPPQQDGGSPIRGYHIEMCEAGTEKWMRVNSRPVKELKYRVEEGVVPEKEYILRVRAINA
VGESEPSDISENVFAKDSDCNPTMDFQTLDLVVVETEKLHIPVPFRAVPSPRITWHKDGK
ELKADERIGFRKEYTSCHLEIDSSVHPDAGVYKVTLENTLGSASATINVKVIGLPGPCKE
IVASEITKSSCKVSWDPPDYDGGSPILHYILQRREAGRRTYVNMMSGENKMCWTVKDLIP
NGEYYFRVQAVNKIGGGEFIELRNPVIAEDQKHSPDPPVDVETHNPSSSTITLTWKPPMY
DGGAKIMGYILEKQQKGEDKWERCNDFLVPVLSYTVRGLTEGKNYTFRVKAENAAGISEP
SRNTPFVKASDTIDPPKVFLSGSLQSGLSVKRGCEICLDANISGSPYPQITWYWNNREIQ
PEPLRKRPEKPLKKKAEKKEEQKKEEEKEEKKAEGEAEEKKEGEVKEGEEKKEGEEKKEE
EKKPEEEAEEVEEPDYPTINERLTINNSRRGVSSILIVDSVRRDHGVYMVKVENDHGVAS
ATCEVNVLDTPGPPVNFKFEEVRKNSVICKWDPPLDDGGSEVINYTLEKKDNSKLEFGWS
SVTSTLIGCRYLVPKLIEKKEYIFKVMAENKFGPGPPCVSKPLIAKNSFEPPEAPDKPQV
DDVTSNSMLVTWNEPNDNGSPILGYWVERREINSSHWARANRNIAPSTELNVEGLLEGLS
YIFRVAAENQAGPGKFSLPSEPKMAQARILPPGPPIARVATTTDHSIEVEWDPPADNGGG
EILGYHVDKAMAGSKDWSRSTERPWKNRAFTVYGVREGAKYAVRVIACNAAGEGTPGFTE
AVFVRNPAEKPVIELDLSVKNGVIIRAGETLLVPATVTGKPYPAITWTKDDGKPDKDRVE
ILSEGNNSILSINNVQRNDCGKYQISAFNPSGTKSAWTRVEVMDVPGPVTDLKPVVVTRK
MIFLNWDDPVDDGGSDLTGFLVERRDIKGHTWRQPVETISSKCECVGIMEGQEYIFRVTA
KNKYGLGVPVELPPIKAIDPQGPPSYPEKFHYTERTKDSITLSWKPPRNDGGSPVIGYFV
EKKRQDQQAFEPCNTEICPDMTMTVNGLEEAWMYEFRIKCANLIGESEPSIPMTVVIQDD
EVSPEVHMLKHFKADCIIVKKGEPIEIPADIIGLPVPKIEWSKDDVVIAKSTEALLIETE
VTGRMNAKTKLSIPATNRRDRGSYMVLASNNMGTAKHTITVMVLDRPTPARNLTVSNIRA
ESCYLNWDPPTDNGGSEVTSYIVEKKEVMKEQPELEEGEKAPPEPQWEEVNSSVIDRKFG
VWNLETNKTYLFRVKAQNRYGISDPCSTEEVLIIDPFGLPGPPEKPTIAEYSKTSMTLTW
EPPRETGGSKINGYWLEKREKGTDYWAKVNKMPVTKRGMKGWEYQVTRLFEGTEYEFRVA
AFNSAGTGPFSGPSDSAFAVDPITPPSMPAAPVVADKTKYNVTLTWKPPESDGGSPIKGY
IVQIQDEGSSEWHKLNDIDSLHPTTEFVVPSLRELKRYRFRIIAVNDIGESEPSPRTSEV
LIEDVQLPPFITIDVLAEELVNIRAGDPIRIPATIKGRPVPKVTWDFEGKAKMEKKNKLH
TLPVDSTVESTDTTSVVNIPVSLRSHSGRYTITAKNKSGQKHVNVRVIVLDVPGPPKDLK
VTDITRSTMRLIWKLPDTDGGERIKSYFIEKKSVIDKAWTKVNAACASQAFVVPGLLEGQ
DYLFRVRAENRLGFGPFTETTEPIRSRDPIYPPDPPTKLKVNLVTKNTVTLSWEPPKNNG
GSPVKHYIIERLSWDTSGKEKETWKQCNKRDVEELTFVVEDLKEGGEYEFRVKAVNDAGP
SRPSATVGPLVIKDQTCPPTIGLREAMEGEEGCDLSIVAKISGCPFPTLTWHKASLAKPE
EKAAVKYDQHFNKLVTQDKCTLLIQQANRHDSALYSLTASNSLGSVTKDIKLLVLGPPGA
PVGPIKLTEVFADRIGLAWNPPTDDGGSKITNYVVEKREDNRKSWVHVSNDPKECAYVVT
RLTENHEYEFRVMAQNKFGVGPPIVSEPEKARNLFTVPGQCEKPTVTEVCLESMTVNWEE
PKYDGGSPITGYFVEKKETTSKRWTRVSREPIRALPLGNNWDVTGLLEGALYQFRVIAVN
AAGCGLPSMPSDPILCRDPIKPPGPPSPKVTDWTKSTVELQWLPPLIDGGSKVTGYIVEF
KEINKELEEKKAQRRLLLSDAEEEKEPEGDEGWQKAKDTEIRGTKFVVPGLKEGGLYQFR
VRAVNAAGVGDPGLVLELIEVKDRTIAPEMDLDASVKEKIVVHAGGTIRIIAYVSGKPAP
QITWCRDDGEVPKEAVVETTGISNSLVIKNCKRQHQGMYTLSAKNEGGERKKAVIVEVLD
VPGPVGLPFTGENLTTDSCKLTWYSPEDDGGSAITNYIIEKRESDRMGWTSVSYTVTRNN
AVVQGLIEGKGYFFRIAAENIIGMGPFIEIEKMVLIKDPISVPERPEDLIITAVTKDSVS
VAWRPPKYDGGAEVTAYVLESRMIGRDNFTRIGGEDKLMDRKFTLKELKEGSSHEFRVSA
VNQVGQGKHSFPTKPVQCKDELEPPTLDLDFRDKMMVKVGDPCLLSGRYGGKPTPVIAWK
KNDEELKADDEISLHSTTHHLNLNISKAKRDHSGLYAVSVENAAGTRTGTCTITVVDRPQ
PPQGPVVFNEVYRNYMVISWNPPLDDGGCAVSNYIVEKRDTNRDLWMPVISSCTRTTCRV
PKLIEGREYIIRIMAQNMYGISDPLLSAETKARDVFKVPDAPKQPVLKEVYQDSALISWE
PPADGGKPITGYIVERKETKANRWVRCNTERIHPKMEYLVTELLKGCEYEFRVSAENEVG
AGDPSPPSKPVFAKDPIVKPGPPVNLQAIDFTKESVTLSWDPPTDTGRGKIFGYLLEFQK
AGEEEWHKVNQTPDSCQETKFKVINLEDGALYRFKVMAVNAAGESDPANVKEPIRVQDRL
EPPELILDASMTREVKARAGTHITLMAAIKGVPFPTVTWKKNEGEVPTRADIETNQAGTK
LEMRFCHRGDCGDYTLTVENPAGSKTATCTVLVLDKPGPIQHLRVSDVRSDSAYLSWKDP
EDNGGTRITNFVVEKKDTASTQWVPVCSTSKKRSMMLKHLMEGTSYTFRVAAENQYGRSE
YVETPKAIKAMNPLFPPGPPKDLHHSDVDKTEVWLAWNWPDRNGGSEITGFLVEYQEEGA
REWEEWKTESIPESHVTGLEEGKTYRFRVRAENAIGLSRPDTTLPILCQEKLVPPIVEVD
VKYIEGIIVKAGTTIRLPAIMRGIPVPTAKWSIDGEEITSQGKIKIDTDNFSTVLSINEC
TRNHTGTYLLTVSNPAGTKTVALNVTVLDVPAAPIGPVNILEVTPDSMIIEWRPPKDDGG
SPVTNYIVEKRESNKETWGGVSSGLLTTQLKITRLQKGAEYVVRIRAENKMGAGVPLESK
PTVAEHTFMPPSPPGKPQCSDLAEDAVTVGWTMPLADGGSPITGYLIERRHMGGKWIRVN
KIPCKDLRYRIQGLFEGSEYEFRVFAENIAGYSGPSPISDPCKPCRPITVPSPPINPKVK
DYSKTTADLVWIKPSRDGGSPILGYTVEMQKADSEEWKKLNLDDDFIKLCAFRVKGLEEG
VTYRFRVRASNMIGDGEPREIPGSITAQDILIPPEIEMEATCRERVTVRVGHNINIFGYI
KARPDPEVIWSKEDTVLENSKRVTLVQNLPMVHLRIKEATRNDHGKYTLKASNVGGEASC
TITVNVLDRPGHCQNLHLTYVTKASCMINWEAPDDNGGSEITNYIVECREPSISGWSMIS
SNCTNRKIKAKLMEGHEYLFRVCAVNKLGPGPAVELKSPLLAIDPIEKPGEPENFRATDI
GKNFVYLRWRKPDYDGGSPNLSYNLEYKAKDAEQWEKLNKGMLTDTFFLADKCVENQTYS
FRVQTVNEGGESAWVKLPDILVKEELQKPVIDLKVAGTVTVMAGESVRMEAALRGKPQPE
VIWVKDKAVGNNPRLSYETGPDYSKFLLTKSKRTDTGKYIITATNTAGTFTAYANVNVLD
VPGPVRNLRITGIGADKCRVVWDGPEDDGGCEVDSYIVEKCETRRMVWSTYSAAVVTPYC
NVTRLVEGNEYIFRVRAENKMGTGPAMESKPVTVKTQFNRPGPPEAPEVTKVSKDEMTVV
WAPPENDGGKSITGYILERKEKRAVRWVPCTKSPISERRMKVTNLIPNHEYQFRVKAENE
VGLGEPSKPCRPVAAKDPIEPPGPPASLKVGDSTKTSITLTWSKPVYDGGAPIIGYSLDL
RLKSEADPEKPSEGWKRIDTRGPLVITEFTIGQLDEKQEYEFKVSAQNQVGWGRHAYLKE
AVSPREILEAPEIDLDASLRKGLAVRAGCPIRLFAVIRGRPAPKVTWKRMGVDNVVRRGH
VDQVDTMSFLVIPESTREDSGRYSLTLSNSAGEKAVFVRVKVLDTPGPVGDLDATNVTKT
TAQLSWLPPENDGGSPILYYIVEKREVDRKTWSKCIEDLKKTSFKVTNLAPGIEYYFRVM
ACNKYGIGVPQDSPRSYLAVDPLSEPDPPKKMDVLEITKNSATLGWLKPLRDGGAKINGY
VVDYQEEGAPENKWTPYSVVKDLTIVVVGLKEGKKYRFRVAARNSVGVSLAREAEGMFEV
KEQLMAPKIILPDIVTARAGSKMVIEAIVAGKPAPVCKWKQGNEDVLTSDRLSLAKTLTT
CLLIIKNVNRKDSGYYSLSAENTSGKVNQILRVIIMDKPGPPEAPLEITELDIDACTLLW
NTPQEDGGSNITNYIVEKCDVSQGDWITVSASCTKTSFRMTKLTTGREYGFRVRAENRFG
ISEPIYSEKMVAKYPFDPPSEPRNLEINKVNKDFVILSWERPSSDGGSPITGYCIEKKER
NSLLWVKANEAVVKATQYTCMGLIEGLEYTFRVSAYNQAGQGKPCKHTDFITARTAVDSP
GKPEPMDVTKNSVSLVWNRPKHDGGSKLIGYYMEYAKLPEEKWTRCNANCMNIQTEDYVV
HGLEEGQKYQFRVIAKTAVSISLPSELSDPITIIAENVPPRVELGVNMKNLIVVKAGENI
FLDAEVFGKPLPKVGWKKDGAPLVLTEGMKVTQKKHVHLLELYSVTRKESGDYTITAENV
NGSKYATIKVKVLDKPGPPASVKIFKVFADHVKMRWEPPLADGGSEITNYIIEKRETSRA
NWALVTSNIHGHNTDCSVEKLIEGHEYQFRVSAENQYGVGDPIMTDAILVKNPYDVPGPC
EPPVITNVTKDSMTVSWKAPANDGKAPILGYMVEKREATELTWAKVNRRPVIDRTIKAIQ
LTEGSEYEFRIIALNKAGLGKPSDPSNAVLAIDPVYPPGPPAFPKVVDSTKNSVSLSWTK
PAYDGGCEIIGYLVEYKRADIEGWATCNVPKKLQATKFVVTGLMENTEYQFRVTAVNRIG
YSEPSEVPGNHMAKDILISPEAELDADLRKALVLRAGITMRLYVPLRGRPAPKVTWTKVD
ANLKERQGILIKTSDWDTLLMVENINRYDAGKYVLSLENSSGSKSYTIVVKVLDSPGPPV
NLIVKETSRTHACITWDAPLIDGGSPVKSYIVEKRLAERKAWTCVSAECHKPSFRITNLE
PGQAYCFRVLAENAYGIGEGCETAGSVRASEQPGPVTDFKALKTTKNSITLGWKKPISDG
GSYVTAYILEQSEGEEKWTQIMKGKNMSHTISELTEGKAYLFKVKALNESGEGPPTELTV
AAKDQFVLPDCNLSNLHDGCYVVKEGTTTRINIPVIGVPYPTATWKKGEVGLGDTGRVCI
EASPGVTTLLIRDCHRGDADTYTINVKNSAGSKDCKFQLKVVGKPGICTAPIKFDEITAD
GITLEWEPPQDDGGAEVSNYIVEKRRTTDNKWATVASAIQKTTMRVIRLHDGIEYIFRVC
AENKYGIGEFLRSDPVIAQHPFNVPEAPAPPEIVSIRHESAILTWADPKDTGGSPITGYH
MEFKERNSLMWKRASKTPLRVKECRVTGLIEGLEYEFRVMAMNMAGLGKASKVTEAVAAL
DPIDPPGKPEVINVTRNTVTLVWTAPKYDGGYKLTGYAVEKLEAGGKTWMKANHVNIHSC
AFTVTDLMEGSQFQFRIRARNAAGALSIPSECTESLTCKDEYEPPSITIDQDMKDGVSVR
AGDTIVISASKIVGKPPPTAVWSKGGREFKNSDTVTVTSTPTSSTLAIKYASWKNTGEYT
ITASNPFGIKEEHIRVKVLDIPGPPGPIEVSNISAEKCTLTWLPPEEDGGCSIKSYILEK
RETSRLQWTKLAENIIDCRHVAHKLIKGNEYIFRVSAVNQYGTGDSSQSGPVRMVDSFGP
PGPPSTPEIDNVSRNAVTISWKRPVKDGGSDIRGYSVERKERRGMRWVRASKRTVPDLRF
KVQGLTEGVEYEFRVTAENKAGFGEPSEPSHPVMTKDIVYPPGPPSNPRIADTTKTTATF
AWGRPHYDGGLEVEGYIIEYKKEGHDDWETETQYPVKVTEYVIGKLQKGGKYHFRVSAIN
SEGVGEPAEVEKVTELMDQETMPDFELDAELRKTLVVRCRASIRIFVPIRGRPIPEVTWS
KENTNLKARAHIDTTESYTLLVIPDCTRYDAGKYQLCLENVAGKKTGFVNVKVLDTPGPP
VNLKPREITKNSITLQWEIPIIDGGSKIHNYIIEKRNATKKAYTVLSTTWQKCSFKFQDL
QEGAYYYFRVSAENDLGVGEPAETPEPIRVSQAPSAPENLYVTDVTSDSASLAWTKPLHD
GGSLITGYVIEAQKKDTDQWVHITTIKALDYTVTDLVEGAEYTFRIMAVNASGRSDPRES
RPAIIKEHTSAPSFDLRGVYQKTVIAKAGDRVKVEIPVLGKPRPVVSWKKGDFAFKETQR
MNIETTSTSTILNISEIKRTDGGQYSMTAKNMLGTMTETITVLVHDIPGPPSGPIKLDEV
SCDYVILSWEPPENDGGVPINNYIVEMRETTGTSWVELAATVIRTTFKAAKLNTGTLYQF
RVKAQNRYGIGPCIQSEPVLAAYPFDVPSQPGSPVVTSFNKDSMTLSWNEPSDGGSPILG
YHVDRKEKNSILWQRISKALVVGNIFKSTGLVDGIVYEHRVTAENMAGLSKPSKPSEPMY
ALDPVEPPGRPVALNITRHEVTLSWTKPEGDGGFSITGYTVERRETPNGRWLKANFNNIL
ETMYTVSGLTEDTTYEFRVFARNSAGAVSAPSQPSEAFTCRDDIEEPRLDVDVVYSSTVV
VMAGEPFKLEASVTGRPIPSLVWTKEGKELEDTGKIEIKTSSFHTTLINKDSLRRDGGAF
ILTASNPGGFAKFTFNVKVLDRPGPPDSLTVTDVTSEKCVLNWLHPTHDGGAKIEYFIIQ
RRETSRLAWTNVATDLQANRFKVTKLLKGNEYVFRVMAVNKYGVGEPLESEPIICANPYG
PSDPPTQPEVTTITKDSMVVCWERPEHDGGSRINTYIIERRDKTGLRWVKCNKRTVTDLR
FKVSGLTLGHEYEFRVLAENNAGLSQPSPSSPFYKAIDTIFQPGPPGNPRVLDTTKSSIT
VAWNKPVYDGGSEITGYIVETCLPEEDEWTIHTPKKGWTATSFTITNLKQNQEYKINICA
TNCEGVGEPASVPGTPKAEDRLLPPEIELGAELRKVVCIRACSTLRLFVPIKGRPAPEVK
WSREHGESLDKANIEITSSFTTLQIDVVDKFDAGKYLVTVENASGSKTAFVNVRVLDTPG
APQNLTVKEVTRNSVSLVWDAPLIDGGSRIRNYIVEKRESTRKAYSTVCASCHKSSWKVG
DLEEGKLYFFRILAENEFGIGLPVETLESIKASEKPLPPGKVSLREVTSKSVTLTWEKPD
HDGGSRITGYIVEMQSKGSEKWTQVMVVKTNEAQVTGLTQGEEYMFRISATNEKGVSDPR
PLSLPVIAKDLIIPPTFKLLFSTFSALAGDDLKIDVPYVACPKATATWLKDGVVLKETIR
VNAEATDKNLHLVIKEACRDDVGTYTIKLTNTAGEATADISVVVLDKPGPPAGPIKLDEV
TADSVVLSWNPPLYDGGCAINNYIVEKRDTSTTNWQIVSATVARTTIKAVRLKTGFEYQF
RIAAENRYGKSSFLLSDNIVAQYPFEVPSSPRSVLVQSVTKESMVVVWEKPSNDGGSKIL
GYHLELKERNSILWVKQNKQLIQETRFKVVGLEEGIEYEFRVYAENIVGLSKASKVSEMQ
VARDPCDRPGKPEAVIVTRNKVTLRWTKPEYDAGIKITGYVVEKKEGGGRWMKASFANVI
ETEFVVTGLTEDQTYEFRVIAKNAAGVFSQPSDSTGTITAKDEVDPPRIDLETKYSQAVV
VNAGETFRLEAGIYGKPVPTVHWLKEGNEITEAARLEIHNTDFIACIIVKEAIRVDGGQY
TLLVKNVGGEKTVNINVKVLDRPGPPEGPISIYGVTSEKCSISWKPPLQDGGSDVSHYIV
ERRETSRLVWTVIEQKVQTLNLKITKLLPGNEYIFRVIPVNKYGIGEPLESEPMIAKNPF
VAPSPPTEVEVSTITKDSMVVTWERPVNDGGSPIQGYVVEKRDKDGVRWTRCNKRTLTEL
RFRVTGLIENHSYEFRVAAENAAGLGTPSTPTVYYKALDPIFEPGPPNNPRVVDTSRSTV
SLTWGKPIYDGGCEIQAYLVEACDVASEEWFMCTPPTGITDTKFTVKKLLEKHEYQFRVC
AINKVGIGEHADVPGKILLEEQLEPPDLDLDADMRKTVNIRAASTLRLFVPVRGRPAPEV
KWGKADGEIKETALIDNTGSYALLVIENVDRFDSGKYTLTAENASGVKSAFISVRVLDSP
SPPTNLTVKEITRNSVTLSWEPPLLDGGSKIKHYIVEKRESTRKVYSPITTCNKMSWKVE
SLPEGGIFFFRVLAENEYGVGLQAKTIEPIKISEKPQPPGKVSVVDVTHSTVTLTWEKSQ
YDGGSRISHYEVEIAPKDSETWSPCASVKGTETEVSNLLKGEEYQFRVIAVNEKGKSDPR
QLVQSVVAKDLVIEPSVRPKVSSYSVQVGYDLKIEVPIAGHPKPTITWTKNGVALKQTTR
VNVTDSAHQTTLTIKDATREDSGMYTINIANSLGSKDATIEVITLDKPGPPTGPVKIEDI
SAESMTLSWEAPTYTGGCPISNYVVEKRDTTTTNWVVVSATVARTTLKVSNLKTGGEYQF
RIFAENRYGKSYAIDSQPVVAQYPFQEPGPPGTPFVSSYTKDYMVVEWHKPPSDGGSAIL
GYHLERKEKNSILWTKINKMVIQDCKFKSTPLEESIEYEYRVYAENIVGIGKCSKVSEVY
VARDPCDPPGRPEAVIVTRHSVKLKWSPPQYDGGSLVTGYIVEKRDLPEGKWMKASFANI
IEREFTITGLTEDNKYDFRVIARNAAGAASKPSETTGSITAKDEVEPPKCETDPMYNQTL
VINAGDTFSLEASVEGKPIPTAQWFKGSVEIENSARSEIKNTDFKALLVVKDAIRVDGGQ
YTLVLTNVAGTKTVPFSVKVLDRPGPSEGPLTISNVTEEKCSLSWLPPKHDGGATISHYI
IQKRETSRLAWTVVSSDCGATMFKVTKLLKGNEYIFRVLAVNKYGVGEPLESEPVIMRNP
FVPPGSPHELEITNITRDSMTVCWNRPKTTGGSDIVGYIVEKRDRAGVRWTKCNKRRVTD
LRFRVTGLTEDHDYEFRVSAENAAGVGQPSPPTPYLKACDPTFEPGCPTNAHVVDTTKDS
ISLAWHRPIYDGGCEIQGYAVEITKADEEEWTLCTPPTGVNKTKFTIKRLTEHQEYKVRI
CAVNKEGVGEPTEIQGVVIPIDKIDPPEVILDSELRKGIVVRAGGSMRICIPFNGRPVPE
VSWAKEDGELPTKVQVEMGEDYTQLSIGICDKYDAGKYILNLENSAGSKSAFVSVKVLDT
PGAPLNLTVKDIKRESVTLTWEPPVIDGGSRIKNYLVEKRESTRNVYSNVDNKCTKTSYR
ITGLTEGTIYYFRVLAENEFGVGQPIETEQSVKTSEPPLPVGKVNLTEVTKTTVSLSWEK
PVHDGGSRIIGYYIEMQPVGSEEWVVAATTKTCEGTVTGLSTGHEYLLRVSAFNEKGKSD
PRALAAPVTAKDVTVEPRFKIRFTTYSLQQGEDLKIEIPVIGRPVPKVEWKKEGQALKET
TRLNVSSTPSSTKLVIKDANKEDSGKYTITATSSIGTTTEEITVVILDKPGPPTGPVKIE
EVSCNFVTLSWEPPEYTGGCQINNYIVEKRDTTTTAWQIVSATIARTTIKVTNLKTGVEY
QFRVSAENRYGKSSAIVSPAVVAKYPFSEPAAPGSPVITAATKDSMVVEWKPPTNSGGSP
IIGYHLERKEKNSLLWTKLNKLLIPDTRFKTTELEEGIEYEFRVYAENIAGISPASKVSE
TTVARDPCDPPGTPEAIEITRNHVTLQWTRPQYDGGSAITGYVIERRKHPDTRWMKASFT
NIIDTQFTITGLTEDCVYEFRVIAKNSAGISSRPSGSTGEITAKDAIEAPDATMDSKFKD
LTVVHAGESFVIDADYTGKPLPEVMWLKDGKEIDKTTPRMEIKTTLTRTILTVKDCIRVD
GGHFVLKLVNVGGIKMIPVNVKVLDRPGPPDGPLEVKGVTAEKCYLHWNHPSHDGGASIS
HYIIEKRETSRLSWTVVEPKIQAISYKITKLLPGNEYIFRVIAVNKYGVGEPLESEPVIA
RNPFTTPSAPSTPEASAITRDSMVLTWERPENNGGAEIEGYVLEKRDKDGVRWTKCNKKR
LTDLRFRCAGLTEGHWYEFRVSAENAAGVGKPSTPTQYVKACDAIYPPGPPSNPKVTDHS
STTVSLSWSRPIYDGGAQITGYVVERKEAGDDEWFVCTPPTGVQETHYTVKKLKENVEYN
FRICAVNCEGVGDHVDLPVSVIAAEKLEAPEIELDADLRKMVNVRATATLRLFVTIRGKP
EPEVKWSKADGTLNERAQIEVTSSYTMLVIENVDRFDTGKYTLTLENLSGSKSAFINVRV
LDSPSAPTNLQVKDVKRHSVSLSWEPPLIDGGAKISHYIVEKREQKRMAFTSVSTNCVRN
SYIISDLQEGGRYFFRVLAVNDLGVGLPATTDQVKVSEAPLPPGKVVVVDVTRHTVTLSW
EKPDHDGGSKITSYIVEMQPKGDDKWTVCSEAKALEATIDGLIAGEEYSFRVIAVNDKGR
SDAKPLATPVVVKDITMEPIINLLFNTYSINAGDDFKIDVPFKGRPQPEVSWKKDGQMLK
QTTRVNVVNSKTSSKIVIKDATKEDVGKYEITLTNSVGTKTAEISVIVLDKPGPPSNIKM
DEVSADFISLSWDPPTYDGGCQINNYVVEKRDTTSTTWQIVSATVARTSIKVSRLNQGTE
YQFRIAAENRYGKSPAVNSAPVIAQYPFEPPSSPTNLHVAHATKTSMLVVWGRPASDGGS
PVIGYHIECKDQSSILWSKVNRGLLAENQFKMTGIEEGLLYQFRVYAENIAGIGPCTKPS
DPVAARDPCESPHNLRVTNITRNSVSLFWNAPEYDGGVKITGYIVERKELPNGRWLKCNF
TNVQGTYFDVTGLTEDAQYDFHVIAKNSAEMLSAPSENTGPVTVKDDVDPPTIIMEDKFR
QLVVIKAGEIIRIDAEITGRPLPVLSWSKDGKEIEAKARCEITSTNFTTTLILRDAIRKD
SGQYVLTLHNVAGTRSVAVNCKVLDRPGPSSGPLAVSGVTAEKCILTWGPPQENGGAEIM
HYIVEKRETSRLAWTLVYGDMKATTCKVTKLLKGNEYIFRVRGVNKYGDGEALESEPTKA
IDPFTVPAAPTNVEVTAVTSEAMTICWERPVSDGGSSISGYVIEKREKTGLRWCRVNKKP
VYDLRVKASNLRDGCEYEYRVFAENSAGLSAPSIPCPLIKAEDPQFLPSPPPKPKIIDSS
KTTVTLTWSKPLFDGGAPVTGYRVEYRQTLDDEWIIGVHNTKNTEFTVVGLTPGVEYVFV
VKSINKIGISDPSAESDKQIAKEREEEPAFEISNEMRKTLIVKDGSSFTMTVPFRGKPIP
AVSWTKPDIDLRVRAVIDTTDTFTSITLEKATRNDSGKYTVTLSSVVGTSSLTLNVRVLD
SPGPPANVEVKEVTKTSATVTWDMPENEGGGPVKNYLVDFREASKKGWTRLTDRCHRLTY
KVTNLKEGEVYYFRVTGENDYGVGIPAETKDGTKITEKPSPPPKLGVTDVSKDSVSLAWA
KPEQDGGSRITGYLVEALEKDQEKWVKCGVTKFTHFTVSGLREKAEYFFRVRAENHAGLS
DFKEMVTPVMVKDQLEPPEVNMKDFPYNTVYVRAGSTLKCEIPLTGRPMPKVSLSKDNVL
LKSTMRFNSEVTPDSIKITLRESVAGDSGRYDITASNSSGTTKSYIKIVVLDRPSAPLGP
VELFDVTEDSVSLTWLPPAYDGGSPITNYIVQKRETTTANWMDVSSAVARCTMKIMKLTT
GLEYQFRIRAENKYGISEHIDSPAVTVNLPYTTPDAPSTPEITAVTRETITLAWKEPKSD
GGSHVFGYHLQMKDKNSILWQRVNRTVIRATHFKVTTINAGLIYEFKVAAENAAGLSAFS
KVSDAVLAIDACEPPINLRISDITKNSISLAWEKPNYDGGSPITGYIIEKKEVVGAKWSK
ANLTNVSDTRFIVTGLTQNETYEFRVMAKNAVGSVSNPSMTAGPATCVDTYGAPEVEIPQ
EYLNEVKYHAGSDVELKFNISAKPAPTIEWFKDGRELKPTAQLSFKHTFEFTSIFMKETT
RLNSGTYEVKVKNSLGSACGIVRLLIQDKPGPPAGEIQFKKVTADNITIMWSPPADEGGA
MVTHYIVEKRETSRVMWSIVSEKLADCIINVPRLIQGNEYIFRVRGVNKYGIGDPLESDP
IIAKNPFVPPSEPSRPKVTMITKSTMTVIWERPALDGGSDIDGYYLEKREKKSLQWFKVV
KGSIRDTRQKVSNLTENNEYQFRVCAVNKAGAGNYSEASDLYKAYDPIDLPGEPSKLRVV
DSTRTSITLGWEKPVYDGGSEITHYILEQMNAEDKEWVIINPQVKMCEYVVSHLKPGTYY
YFRVSAVNCKGKGEDIKMYQPVQAKDILEEADLDLDVSMTTQYTARAGRDIEVFIPLKGR
PAPNVTWRRGDRNMASDNRYTISSTERSTTLLIPKVTRDDCGKYVLEIENGVGEPKVITV
SLKVLDSPSSCQKLIVKNVTRGQLTLSWEAPLIEGGSPVTNYIVEKKASTMKAFQVITVE
CLNTSYKVSGLEEDVAYFFQVSAENEFGVGDPCETTEPVRATETPGGVKDLAMGDSTKNS
VTLQWTRPDHDGGSHITEYIIEKRSLEEVNWSLGATCKRCTCEVTGLKENTILDFRVFAK
NEKGRSDFSQIGPITVMDFIIPPEAILNDYPNGELAVRIGQNIHIELPFKGKPRPAISWL
KDNFPLKESEKIRFRTTDNKTAVTVRGAKKENAGQYTLVLDNRIVKNYFDINVITLGPPS
VPVGPIRFDEIKAQSIIISWDEPKENGGGEITCYSVEKRETSQANWKMICSSVVRTSFKI
PNLVKGTQYQFRVRAENKYGVSEPLNSSDIIAQHQYKAPGPPGKPVSYNITSDGITIKWE
APDFDGGSPILGYHVEKKDRNSLLWQKVNSTLISNKEYRIIGLLEGLEYSFRVYAENNAG
ISPVSEQSKHARAISPVDPPGTPVCIDVTRDSVSLQWDIPKRDGGSKVVAYSVERRQGRG
KWLRCNFTDISETQFTVTGLSPGDRFEFRVIARNAVGTISPPSNSSGYIMTKDESIAPEI
EWSPDQVLTLKAGENVRLSCTITGRPLPQIVWYKDGKEIDKRTMIDIEITTGIGTSSLFI
RDADRNHRGMYTVEAKNSSGTRKADVNVRVQDTPGPVEGPIRFTGITADKCTVWWNPPEN
DGCAAITHYVVEKRETSRISWALVTSKCEACSYNATNLIKGNEYQFRISAVNKFGVGKPL
DSDSVIARMQYTVPDAPGTPDATHVTGDSITLCWTRPRSDGGNEIKHYVLERREKKSLRW
VRVSSKRPITELRHRVTNLTEGNEYEFRVMAENGAGVGPASSTSRLFKCREPTSAPSAPT
VIKVIDSTKSSVTLKWTKPVFDGGMEIIGYNIDMCKASLEEWHRVNSQICIHNTYTAKGL
VPGELYKFRVSAVNGSGQGEASVMPHPVQALDRLTSPEIDIDANFKQTHTVKNGGTVSLH
IAFWGKPAPLATWSKVDGELPVMADVNTTDTFSTLTIEGCTRYEAGKYTLSLENNSGHKS
ITFTVKVLDTPGPPGAISFKDVTCGALTLMWDAPSNDGGARIHHYIVDKREASRLAWQEV
SSKSSRQTVRVTGLDIGVPYLFRVTAVNQYGQGEPHETTEPITATEEPAPPKRLDVVDTT
SSTASLVWLKPDHDGGSRIRGYIVEFRATGTDRWIMYGEAKLQKMLVEGLSENTEYDFRV
KAKNDAGISEPQGTFSSVVIKEPRIEPTADLSSITNQLITCKISNTFTIDIPISGRPAPK
VTWKLEEMKLKETDRVLIRTSKERTTLIVRDSKRNDSGKYYLILENAAAVKTFTVTVVIV
GRPSPPTGPLEVSGISSETCTLSWSEPADDGGTEITNYIVEKRESGSASWQVVNSSVQRT
TIKVTHLTKYMEYTFRVCAENKFGVSKSIESSAVVIEHPFIPPSPPTRPDVVSVSANAIS
IKWDVPYADGGSKVTGYWIEKKERNTILWVRENKLPCLECHYKVSNLIEGLEYQFRVYAM
NIAGLSKASEASRPVVALNPVDPPGKPEITDISRSSISLCWTVPFNDGGSRIVGYIVEKK
VYSTDEWDDNRWLKCNYTTITENYFTVTNLGEGETYEYRVIAKNAAGVHSVPSESTGPVT
CKDEYSPPRAELDSKLVGETVTVMAGSDLVLDGAVGGKPEPTVYWSKGDKILDLGEKYSL
TYTSTRAMAVIKNCDRYDTGRYILTVKNASGIKTANVNVKVLDTPGPPADKIVISRVTEE
KCTVAWKIPYEDGGDIVSHYIVERRETSRLNWVIMETECKSLSCVSSRLIKNNEYIFRVR
GVNKFGPGVPLESEPIIARNAYTVPSQPGTPEATAVAKEHIIIEWLKPESDGGNEIKTYI
VEKREKSSTRWTRVNKTYTIYDTRLKITGLLEGSEYQFRVTAVNAAGDSQPSDATPYILC
RDPTYTPAAPSVPRISDTTKHSISMTWTRPMYDGGSDVSGYVVEILEEGSEQWYRATTKP
LKTNEYVAAGLAANKKYRFRVAAINSSGTGEFSEASAEIEPLERVEMPDLELADDLKKTK
CLRAGGTLRLLVFVSGRPTPVVAWRKTGVELQSRGYIETTDSYTALTMEKVNRYDSGKYV
VEAENPTGKKTATILVKVYDTPGPPSSVRVKDYTKESVVITWDVPTIDGGAHVSNYIVEK
REANMKSYKTVTTECRKTLFRITGLEEGAHYFFRVLPENIYGVGEPCETTEPVLVCEVPS
VPMDLYVVDVTKSSVTLHWDKPLHDGGSRLTGYIIEACKVGSDRWSAVATVKASSSQHTI
QSLTENDQYLFRIRATNSRGTSEPMDIVTPVTIQDIKVMPKIDMTSIPQKMIHVHRGKPI
DLNIPIKAKPQPVCSWYFGGAKLKDSLDRIKIDSNSKYTNLVIRDTTINDTGDYTLEVKN
TIGMATEVIKVIILDKPGIPVGPVKIEEVDGVSVTVSWEPPEKDGGANVSGYVVEQRNAH
HPGWTTVSESVTRPCFKFTRLTEGTEYVFRVAAMNRFGVGGFLQSEVVECKSPKTIPGPP
SQPEVIDVTHEGMTVTWHPPEDNGGSTIAGYIIERKEARSDRWLRINKNPVTMTRYRSSG
LIEGLEYEFRITAINSRGTGKPSESSAITVAMDPIEPPGSPVQPRVTDTTRTSVSLAWLP
PEEEGGSVVSGYLIEMQKVDQVEWTLCNTTPTKMCEYTLTHMPQGAEYKFRVMACNAGGA
GEPAEIPGVVKVQEMLGYPDYELDRKYEEGYVVRQGGVIHLSVPIKGKPVPIAKWTKDGR
DISHRAMIATYDDITELVIKEAHRDDTGTYDLVLENKCGRKAVYIKVKVIGRPDAPEGPL
EFDDIQARSVRVSWRSPSDDGGSDILGYIVERREVPKAAWYTVDARVTETSLVVKGLKEN
VEYHFRVFAENQFGVSRSLKSEESVLPKTPLCPPEPPSNPPEIMDVTKTTVSLSWSRPRD
DGGSRVTGYYVERREVSTEKWVRHNKTHITTTMFNVTGLIPSAEYMFRVVAQNDIGQSEA
GPASEPVVCKDPFDKPSQPGDIDIVSITKDSITIHWLRPEHDGGKEILGYWVEYREAGES
AWKKCNKERSKDRQFTMGGLMEATEYEFRIFAENETGLSRPRRTPMGIKTKLSVGEAPAL
KEEIEDVTTKLGTSGTLTCGIIGRPLPEIKWYRYGKELIQSRKYKMSSDGRNHSLTILTE
EQEDEGLYTCRAINEAGEVETSGKLRLQAPPQFHPGFPLKEKYFAGAGTSLRLHVVYIGR
PIPQIMWFYGKKPLNASENVIMENTESYTHLVVRNVQRKTNAGRYKVQLSNVFGTIDTVL
RVEIQDKPCIPEGPVIVEALLKNVVVISWKVPKDDGGSVITNYIVEKREAKEGEKWHLVS
SSVSGTTCRVPNLTENAGYYFRVSAQNQYGVSEPLEIPSVVIIKSPYDKPGIPQQPFIIS
SSKDSCVVCWKPPSSDGGAKITNYYLEKREKKQNKWMSVTTKKIVETSYEVQGLIEGFEY
EFRVKCQNIGGESDWSEISAPIIPKSEQAPRAPVFREEIRDMTVKYHANATFVTKVVGHP
KPVVKWYRSGKEILADGTKIKALEFKGGYYQLVITAAEEDDASVYQVRATNSSGSISTTA
NLEVEVPAKIHLPKELQGMGAVQAVRGDQVTIKIPISGKPEPAVTWQKGQEILSNSLYHQ
VITTRSFTSLVFQKGVQRRDTGYYIITAKNRFGTDKQTIEVNVADIPDAPKGLVVNDIAR
DSITLTWEPPANDGGSDIIGYIVEKCPTTADRWIRAGHTDDCSITIINIFGKTKYQFRVI
AENQFGLSPPSVPTEPITTKEDKSVIRNYDEEVDETREITKDEALFYKVKELSSKYIISE
ELARCQFGVVHRCVEIATKKTFMAKFIKVKGTDRELVLREIEALNVARHKNIIYLHEYFE
SMEEIILIFEFISGVDIFERLGTSNFELSEQEIVRYLRQVCSALKFLHSQNFGHFDIHPA
NIVYTTRRSSSIRIIEMGQSRLLVPGENIRMLFSAPEYYAPEVHRHDLVTTATDMWSVGV
LAYVLLSGLNPFAAESTTKMIENISNCEYLFDREAFKDISLEAMDFIDRLLVKDRKLRMT
AHEALEHPWLKMKIENVSNKVIRTLRHRRYYQSLVKKTDTIVSAARVAYGGAFRNQRGLD
VGRVKIGTEYHGLRAGPVMHGSAEEGGHVRFTCILVSYDKSTQVSWYFGNRQLHPSPKYE
ISYNNGFASIYVKDIEESDDGVYRCKVVSDDGEASAYGELFVETVRSIREYYMSRTIKKL
RRWVDKSKLLQRPPEFTLPLYNRTAYIGEDVRFGVTITVHPEPHVAWLKNGEQLKHDDSK
YTFTSDKGLYQLLIHNLDISDDAEYTVMAHNRFGEDSCKARLSVIPHPVTEETLRPMFKR
LLANVECVEGESVCFELRVSGVPSPTLKWEKDGHPLQFGPKVVVIQEDIDYHVLHIRETL
LEDAGVYKVTAANSAGSASCQATLKVDRITYTRREYKSEEEKHRHVQKQIEKTNKMAQHI
AATEELVPLNPTAQEALKFAAEVYKPAVSTKNIEGEFDITEEKTETKKLEEERRIFLPYE
IPVPVVHDPKALDEDKAIKQFVPLSDMKWYRKLRDQYEIPERTERIVQRRQRRIRLSRWE
QFYVMPLPRITDQYRPRWRIPKLTLDDLETVRPARRSPSPESEASFRSRRRSLGDLSDEE
LLLPVDDYLTMRKTEEERLMLEDELELGFSASPAGSPVRVQRHALEHEERRLEVRHAAAE
VTETKKKRTISQYMRRRRSLSPTYIELMRPVSELIRPPHARPPVEAEGEVVERRSPTPER
TRPRSPSPVKSVERSSRSSSRFERSARFDIMSRYEARKAALKSERKYQVVSQTPFSLDHA
PRVTVRMRSHRIPLGQDTKFTLNIQAKPEAEVCWLHNGSEISESSEKYIFTNMSGVLSIT
ILDCQEEDSGTYRCMCSNSRGEASDYATLEVYGGGYTTFSSRRRDEEVPKAHVPEVSRID
HYHTTHFKTGYTSQTHFEVEESKSKLTETHEVVSRERFGASSERFSSAERYDSSIKYASA
EYLSSSSSYSSEKFSSTEKHVTSEAKLKSSSTTVADQVTVADQVTVRKEKPSVPAKILTK
PKSVTVNEGETARFSCDIDGEPAPTVTWIHERTTIVSSQQIQVTTTQYKSSLEITSVRAS
DEGSYTVVVENSAGRQEAAFTLTIRRPAPKEEVKAVKHPEPPVKTPTPVVTKSPEPAPSI
ISPAPSVKSPEPSVKSPEPSVTSPTPSIKSPTPSVKSPEPEEVKPSKSVKSPEPPAPSPA
RSLKSPTPGVKSPEPEGVKSPRGLKSPEPRLKSPTGIKPPGSVKSSEPEEVKSPRGLKSP
EPAGIKTLRGLKSPEPAGIKTQKGIKSPEPSGIKSPRALKSPEPEGSKSPPRVKSPPPIM
SPKRVVSPPTVKSPIPKPPKVLSQLTAEACEGSVRMSCVCESSVGEVTWYVNGRRLSQSS
RFEMHYSEGSCSLLIHDLTDSDQGEYACEMTSEGGVSKSSFSFKGQVFQSIHKKITAYRE
QQVALKAGSMVSHKESSSSMSSSMMAKKEIHTMEESSSFSSASAHQTMMSSMMESSSFSS
MAAEMKFETMSMSSMSSMASETYAMSSSSLTEMTSQLEGSSLRAIGSAPRIEALPEDISI
EPGKVLTVACAFSGDAKNIEWSCGGKTIVVTAGGRFHIETTDDLTTLIITGVKQEDAGAY
TLKLSNELGSDTATVHISIRSV
NT seq 79629 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggccagaagtcagctggttccacaaccggcagccggtccggcccaccaagaac
gtggtgttccacttcgacgaggagacaaacgttgcaacactcatcatagtggacgctttt
tctgagcatgcaggacagtactcctgcagggcggccaataacgccggagaggccatgtgc
tccgccacgctcaccataaccagagaagaagaaggagtgacccatgtgagggagcagatc
gaaaccaccatggagcaggaagttaaagtgccacctgttttcaagcagaaaatcaaccca
gtggacatcaatgtcggtgaccatgcaaagttcgactgtgagaccgaggatgctccaaac
gtgacctttaaatggaacaagtctggtattgaaatcagacagagcgacaagtatcggatc
gttagccaccccaccggttcctctctggagatcctgaacccggtgaaagctgacagcggt
gactacacctgcaaggcttcgaaccagcacggctcagacagctgctccgcctcactcgtt
gttactgagatgtacccgccagtatttgtttcaaaaccagatccaatgaccttatttgtg
ggcaaacaagctgttctgcagtgctcactcactggatcttcacccatggaagttgtatgg
cacaaggacaatgtagtcatctcctctgaaggaaactatgtcataaagtgcgaaaagaac
aagtattcacttcatataaagagtcttgagttgactgatcagggggtgtacctgtgcaag
gcctccaacagtgtcggcacggctacgtttactacagagctcagagttattaacaagccc
agcttcgttaagccctttgagtcggtgtcagctgctgtcaatgacccgctgaggctggag
tgccaggtggacgaggacactggtgtgaccgtcacctggaccagggatggtaaaaaagtc
caccaaagcatggactgtaagctgtcttttgaggacaaagtggctgttcttgagataccc
aagtccaaacaaaaggactctgggaaatatgtgtgcacagccgcaaatgaggcggggagc
tcctcctgtgaggctgtggtaacagttcaagagccccctgcttttgtcaggaaaatggaa
cctaagataacatggaagcaaggtgcacctgcacgcttacagtgcactgttaaaggatca
ccagaacttcacatccactggttctggaacgacagggagcttagtgatggagacaaatat
aagctcacctttaagaatggagttgcttctgtggagattttgaaccttctggtcacagac
agcggcacctacacctgtgaggtgtctaataatgctggtagtgagagctgcagcaccttt
atagctgttaaagagcctccaactattagaaaagaccttcagactctagaagctgtaaaa
ggagcagcagctcatttggagtgtgaaatagcaggaactgctccttttgagatcagctgg
ttaaaaaataagaaacccctcactagtgatcagaagtttagaataatctcccaggattct
ctgtcaaggctggagatccagacctttgaaagtgcagatgttggagattatcagtgtgtt
atatccaacgatgtggggaaagttaccaccaaggccttggctaaactgaaagagccgcct
tctttttcaaagagagttgaaagtgtgacggccgtgttggggaactcagtaaaactacag
ggaaccataaagggctcatctcctatcactgttaaatggaaaaaagactcagaaatcctc
agagatgatgatccaaacatcaggatggtgtttgagaacaatgttgctatcttgtccata
gcagcagtggccatcagccatggcggcaagtattcatgccaggcagaaaatgaggctggg
caacaaaaatgtgaagccaccctgactgtgcaagaacctgccagaatcgtagaacctgca
gagtccattagtgtgactgcaggggattcggccacactggagtgcaccatttctggaagc
ccagagttgaaagtgaagtggtttaaagatgggaaggagatgatcagtgggcgtaaatat
aaaatgaccctgaaggagaacgtcgccaccatgaagattctgaccgcagagaaaggagac
acttcagagtacaagatggaggtgtccaataaagttggaaaagcccagtgcacatgctca
gtcacggtcttagatcgaataatgcctccaactttcaccaagtccctgaaaagagttgat
ggcaacattggtaatgacatctccatggactgcaaggtgtctgggtcccaacccatgacc
atatcctggtttaaagatgaccaggaaatagaatctggagccaagtttcagcctgagttc
aaagacagctctgctacactgaggatcagtcggctggagaagaccgactctggagtttac
aaatgcagagcctccaactcagctggctttaaagaaaccagcggcacactctacgtaaaa
gagcccccagtgttcacagagaaaccagacaaccaggatgttatacccggagccaaagtt
tccttcagagcaactttcactggaactgctcctttggccatcaagtggttcaaagaggaa
aaagagattgtaactggaggcatttattttataaagaaggatgcctcttccagctctttg
gagcttcactcagtaaaacccagtgactcctccaaatacacctgccaagtgtccaacgat
gcagggaaggtggactgcaccgcagtcctgtttgtgaaagagcctcccgtctttgtgagg
aagctcgatgcgaccaaactcgtcaccagcggcgactccaccaggctggagtgcagagtg
acgggcagccccgtcatcagtttcaaatggtttaaggatgaaatggagatcagctccagt
cctaagtactcaatcagcctgacggatgtagaggctactcttgaaattttaaactgttca
gtggaggacagtggagactatgtctgtgtagcatcgagtgaggcaggaagtgaccgctgc
agcagtacagttacagtcaaagaaccaccagtgtttatacgtagcttggagtccaaagat
gtggtgaagggttctgagatgattttggagtgccaggtttctggttctgctcctttcact
gtgtcattttataaaaactctaaagtgatcagaaatgacagacgacaccggatcactgta
aaagaggacctgctggccctgcaggttctggcggtggaggcaggagatgttggtttgtac
cagtgtactgttgagaatgaagttggcagatcgtcctgtgaatgtcaagtaacccttaaa
gaaccgccatcatttgtaaaaaagcttgagaacctcagtcctctggttagcagtgacgtt
tctctgcagtgctctctgaagggctccgagcccatcgtggtcacctggctgaaagataac
catgagctgaaagaggctgaaaatgttcacatttcatatgagagcaggactgctgtgctg
ctgatcagcagcttacagagtcaacatggaggcaaatactcatgtcaggctcagaatcag
gccggcagccaaacatgctcggctgtactgactgtcaaagaaccagctaagatcacagaa
gaagtaaagtctatcagtgtgactcagggggatccagccacaatggaagcccggttttca
ggcacaaaacccctgaaggccaagtggctaaaggctgggaaggagctgacctcaggacag
agatttaaaatacagagcaaagacaccagctctgtgctcaagattatcaaaactgagaaa
agtgacagtggtgaattcacctttgaggtttcaaatgatgttggtcaaagttcttgcgag
gccaccctcaccgttctcgatcaagtaattcctccgtcctttacaagaaaactgaagcag
acagaaggtatcaaaggatcttttgctcagctggagtgccttgtggccggctcgctgcca
ataactgtccagtggttcaaagatgagaaggagatccaagctgatgagaaacacaaatgt
acattctttgagaatgttgcttgtttggaaatctctgatctgaacattaaagacggtggc
agttacacctgcattgctaaaaacaaagcaggaacagtccaatgctctgggatcttatta
gtgaaagaaccacctttcattcttgaaaagcctgaatccatgaatgttttgcctggctcg
aaggtccagtttaatgttctggtctctggcacaccaccactgaccatcaaatggttcaaa
aacaagaaagagattttatccagtgctgactgctctgtggtcaaagacaacacttcaacc
acactggagcttttctttgctaaaatctctgattctggagattatgtgtgtgaaatacag
aatgatgtgggctctacttcctgccaggcagcactctttgtcaaagagcctcctaagttt
acacggacgccagctcgtgtgtccgtggtgcgacccggtcagagtaaagtgtttgaatgt
caggtgactggaacacctgagatagacatctactggttcaaggaaggctctgagctcagt
gccagcgatcggtacaagatgacctttgttaactcagtggccactctggaagtctgtgga
gccgataccaaagacggcggtctttactactgtgaggctcgcaatgaggccggcagtgag
agctgcagcatggagctgaaggtcaacgaaccaccatcatttattaaagaactgtgtgca
gctgatgctgtgaagggctccaatgcctgttttgagtgccaggttgcagggacaagtccg
tttgagataatgtggcacaaagatggaaaggaaatcaaacccagtgctaaacatggcttc
tcccagatgaatgacactttgagcctggaggtgcacaaatgtgatgctgtagatgttggt
gaatatcagtgtactgtagctaacgaggtgggaagctgtacctgtaaaacaacactaagc
ctcaaagaccctccaacatttaccaagagaattgagaacagtgtcactgttctgggtaaa
atggcagagtttcagtgtgttgtggtaggctcgcccactctgtctgtacaatggcagaaa
gatgagaactggatcctggaggatccaaagattgagagaacatttgagaacaatgtcgcg
actctcaagattcctgcctgcgaggcgactcatggcggtaaatacacctgtcaggtgata
aacgaggctggacaggataagtgctttgcttctctcacagttcaagagcctcctcagatc
ttagagaaacctgaggagatcaaagttaccgttggagatccagtcagtctggactgtaag
gtgaaaggctcacctgagctcaaggtgagatggatgaaagatggcagggagcttcagtcc
atcaggcagcacaagctgatctttgagaacaacatcagcagcctgaagatccaggctgct
cagagagcagatgaaggagaatacgtgtttgaggtgtcgaaccacatcagcagctgctcc
tgtaaagtcaaagtggttgtcctagaacaagtgattgccccgagcttcatcaaaccactc
atagacatgcaggagattttgggctcctttgttcagatctgttgtaaaatatctggttcc
ctccccatctctgtggagtggcagaaagatgggagtaaaatctcaagtggtgtcaaacac
aaactcattcagcaggacaactctgtgtccttggaaatggaacagcttgagatatctgat
gcaggatcttactcttgcaaattgaccaatgcagcaggaagctgtgaatgtagtggatct
ctcatggtcaaagtgcctcccagctttgtgacgctgcctgagtcgcaggtggctcttccc
aacgccacagtccgcttcaaaagcacatttaaaggcacgcctcccttcactgtcaaatgg
ttcaaggaggacacagagctcatgactgggcccagttgtttcacaggagtggacgaaaca
tcgtgcttcttagagctctattcagtggctgtaactcagactggagtttattcttgccaa
gtcagcaatgatgctggttctgtacgctgcagtgcagatttaacagtcaaagaaccacct
gagtttgtgctgaaactccctgccactaagtttgtgaagcggggtgaatcactccggctg
gagtgtaaagtcagtggctcagcccccctgaaaatgacctggtacaaacatgacaccaag
gtctcagaggaggggaactgcaggacatcgtttgttgactcggtagcagtcctggaactg
ctgtctagcagctttgatgatgatggagtttacacgtgtgaagctcagaatgatgctggc
agtgtcagctgcagcaccactcttactgtgaaagaccccccatcctttgtgaaagtaccc
cagcccatcgaggggctgaagggtaaggatgttagcttgtactgcgagatgagtggttcg
gctccgttccaggtcacctggttcaaagacaggaaacctctgatggagagcaggaagtat
aaggtggtgagcgaaggcagctcggcgacgctgcatgtcattgggatagaggctgcggac
gccggcgaatatgagtgcaaagtgtcgaacagtgtaggaagtgacagctgcaacacgtcc
gttaaactcagagagccgccgtcgtttgtgaagaaactgtcaaacatgacagtaatactg
ggagaggaggtgacccttatggccactgttaaaggctctgaacccattactgtgtcctgg
gttcaggacaaggatcacattctcagggacagtgacaacaggaaaatcacctttgagaac
aaccaggtcacactaaaagtctttaaagctgatgcaaccacagcagggaaatacacgtgc
cagctcagaaacgatgctgggactgtggagtgtttcgcaaacttgactgttatagaaccg
gctaagattgtggataaaccggacgctctgagcgtgacggcaggagacatcgctgccctg
gaggtcaaagtgtgtggaacgccggagcttgtccccaagtggtttaaagacggcgtggag
ctggcctctgggaggaaatacaagatctccttctctcggatgatctccagcctgaacgtg
gtcaatgctgagaagctggactctggagaatacacattcgaggtcatgaaccaagtcggg
aaggacctgagtaaaattaacctcacagttttagataagattgttcctccaacgttcacc
agaaaactgaaggactgtaagatggttgtgggagaagcaacagagatggagtgtaaagtg
tcgggttccccacctttcaccatttcctggtaccacgatggcgaggagatccagagcggg
ccgaaccacgaggtttcattcagcgacaacagctgcacgctcagagttcccaccctgaag
ctgtcagactccggagtttataaatgtaaagctgtcaacaaggcaggatccacagaaact
tcagcctcattggctgtcaaagaacctccatccttcgtggttcctctgcagccggtggag
gccatgcctggctccaacgtgacgttctcagctatagtgaagggcagcacccccctcaaa
ctgaaatggttcagaggaaccaaggagatcctgccaggaaaggactgtaccttttccctg
aaggataaccaggtcaccctggagcttttcaacgtgaaccgatcccacactggagagtac
acctgtcaggtcattaacgacgccggaaaggaaagctgcgctgtgaacctctccgtcaaa
gagccggcagccttctctaagaagctgaaggacgtgtcggtggaaaagggccgacctttg
accctggagtgttcctacactggaacgccaaagatcacagtgagctggttcaaagatggc
cagcagatctttgcttcatacaaatacaacatcaccacaacagaaagctcctgcatcctg
gagtgtctcagcactgacgacaaggaggctgcggggacgtactgctgccaagtgtccaac
gacgctggaaaagacacaagcgaggccgttgtgtctatcctggagcctccatactttgtg
gaatctctggagcccatggaggtgacggcaggtgatgctgtgtgtctgaagtgtcaagtg
gcgggcacacctgagatcaaggtgtcctggttcaaggctgatggtaaagtccggtccagt
cctacctgtaagctggagtactcgaagggcgtggcctgtttgaagctcagcaaagccacc
aaagctgacatcggggagtacacctgcaaggcagagaacaagattgggtcttcctcctcc
acctgcagactgaatgtgctggaggcaaaaacgccgccgtccttccccaagaagatcact
agccttcaggagacggagggccaggcggtccgatttgagtgccgcgttgccggttcgtca
cccatcgaggtgtcgtggctgaaagacggcgagcctctgactgaagggggcgagttctcc
atgatgtacgacgacaacacagctgtgctgcagatcggctgtggagagatgaggcattca
ggagaatacacctgcgtggccaccaacagcgtgggctcagcttcctgcagagctaaactc
accatgcaagaacccagatacgctccggtctttgacaggaagttgtcgcctctcgaggtg
acagtgggcgacagcattgaactggagtgtcacatgactggctccgcccccattaaagtc
acatggtccaaagaccataaagatattcgctctggtggaaactataagctcagctgtgtg
gataacactccccacctgagcattctgaaggcagataaagctgacacaggaaaatatttc
tgccatgtttctaatgacatggggaaggactcgtgttcagctgatatcactgttaaagag
cgcaaaaatcctccggtgttcaccaaaaagccctcagagcacatcgaggacacggagggc
aaactggtgaaaatcgagggccgagtcactggatctcagcccatgtcggtcagctggttc
aaagacgacaaggagatcctcctttcagacaaatatgacatcagcttcaagagtaacgtg
gcggttctgtgcattaagagcagccaggtgtcggacagcggcaggtactcctgccaggcc
tccaacgaagcaggaagaacctcctgcgacgtcactgtgggcatactcgaagccaagaag
cctccggtgtttgatgtcccgctcaaaccggtgacagtagacgaaggcgacagactgagc
ctcaggtgtcacgtctgcggatctcctcctctgaagatccagtggatgaaggacaggagg
gagctcacatcagctggcagcaccaggatcagcttctctgaggggacggcttgtgtggaa
atcagctcggtctccaaacacgatgccggcgattacctctgcaaggctaccaacgaggct
ggcagcgagttcagcaaggccaaaatcactgtcagagagaaaccaggagcagctccacct
cctgctgaagctcctgcagcagctccgaccaaaaaactggagaacctgttcttcatcgag
gagcctaaagctgcccacgtcacagagaagggaaccgccaccttcatcgccaaggtgggc
ggggaccccatccccagtgtgaagtggatgaagggaaaatggcgccagctcacacacggc
ggccgcatctccattgagcagaagggtcaggaggccaagctggagatcaaagaggtgacc
aagtcggactcgggtcagtaccgctgtgtggcctccaataagcacggagagatcgagtgc
agcgcagacatgcatgtgggcgataagaaagtagcaccgcagctcgaaggagacctccga
gctaaactgaagaagacaccatcaaagcagaagagtccacaagaggaaaaggacattgac
attgttgagctgctgagaaacgtagaccccaaagagtacgagaaatatgcccgaatgtac
ggcatcaccgactacagaggtctgctgcaggccatcgagcagcttaagaaagaaaaggct
gaagaaagtggaagaccggaaatggaacgtggagacagagagtctgatgaggacatggct
cgactggtggccgacctgcagaagaggatggagaggacagagcccgtcactgtagtgaca
gacatctccaaccagtctgtctttacccacgaggacgcggagttcaagtgcgagctcaag
atcaactacccagagatcacgctgtcctggtacaagggcacgcagaaactggacaccgga
gacaaataccacatcagcatcagcgacgacctccacctgctcaaaatcaagaggtgtcag
ccgtcagaccagggcaactaccgggtggtgtgtgggccgcacatctccagcgccaagctc
actgtcacggaggtggaggtggagaagcacctgcaggacacttcgggtaaggagggccag
ccgtgcacgctgtcatgtcagttgtccgttcctaacgttcaggctcagtggtttaaaaac
gacctgcagttagagatgaagggcaggtactcatctgaggtgaaacacaaggttcagaag
cttctgatccgagacctgaagcccgaagaccagggcagatactcctgcaggtaccgacac
ctggagtcctcggcggagctcagggtggaagctgaacaaattcatttcaccaaacgcatt
cacaacatcgaagtccacgaactgcagtcggccacctttgagtgcgaggtgtccttcgac
aacgcgatcgtttcatggtacaaagacacctgggaactgaaagaaagcattaagtacaac
ttcagaagtgagggccgaagacatttcatggtcatccgaaatgtgaccatcgaagacgaa
ggcgtgtactcagtcattgtgaggttggagcccagaggagaggctaagagcacagctgag
ctttatttatctgccaaagagatcgaattggcaatggtgccaacagattttccggactcc
tcggttctgaggcctgaggtgccctcatcagtggagatccaagaatcgactgaattctat
cagtttgaagaaaagatggaacacagagaatccgctgaatattcatatcagtacgaagag
gaggtgcagcagaaagtggaggttcagagctggacggaggagacgataacacagcaggtt
tcagagatccaagctgccagagttgctgttgaggagaaagtggagaccaagacagtagag
ctgagggaggaactcccgactaaagttgagaagaagcttaaagagaagccggcagcagct
gtagaagaacctacacctcacagagaactggaggtcagggagccagtggaggaaaaggtt
ccagtagtttcagtcccggagaagaaggaagctccagctcccaaagaaccagagacggtg
aagaagccgttttttgctcccccgccgcctgctgagaaaacccagctgccaacaaaagat
gagcccaaacctcaggttccagcagaacccaaaaaggtggtgccccaagctgagccgaag
gtagaaccagaaccaaagcctaaacctgcagcaccgcccaaggcagaaccagaaccaaag
cctaaacctgcagcaccgccaaaggcagaaccagaaccaaagcctaaacctgctccacct
cccaaggcagaaccagaacccaagcccaaacctgctccagctcccaaggcagaaccagaa
cccaagcccaaacctactgcggctccaaaggcagaaccagaagtgacaccggtggctcct
ccatccaaagcccccaaagaggctccaaagaccaaaccagaaccggcagtaaccaagcca
caaccagaagcccccaaaccaaaggtagaaccagagaaaacaaaaccagaagttcgtaaa
cctgagcctcccatcacaaagcctgaaccttcagttcaaaaaccagaaccagcaccagta
ctaaaggaacctgagagaaaagttccagaagaaccaaagaagaaggtggtggctcctcct
ccacctcctccacctcctccccctcctcctgtcccacagaaggttcagaaagaagcagaa
gaaccaaagaagaaaccagttaaagttcctgtggaggaaaaagtcccggagcctccaaaa
gccaagaaagccgaacgtggagaggttcctcccaaagaagaaccagctcccaaagacaaa
gctttgaagcccaaacagaaacctgaagagatgccccaaaaagtacctctgaaggtctct
gaggaggtggttgtgctggagaccaaacctgaaccagaacctgccagaaaacctgcaggg
aaacctgaggtgaaggaaaaacctcctgagaggatcccagataaggtagtgacacctgag
aagaaacaggaggtgactgtgaagatcccagagaagcttcaagacaaagtggaggagaag
gttcctcctcagaggaaacctgataaaattcctcagaaggaggctgaggagaagaagaag
ccagctgaaaaagtcccagtgaagcctgaagaggtaaaacttgaaaagaaacaaccagag
aagatctctgtggcagaaaaggtttctgttaaaacacctgagaaggttgaagctaaacgg
gcgtcagaagaacctgcttctaaagaaactgaagttcagaagatcgagaagatccgtccc
aaagatcaggagaccatagtctcagctcctgaagaagttcctaaaaaggacaaggagact
ccaccacaagtcaaagaaactaagccagctgctcctaaagaagaggccaaaccaaaagct
gctgtaaaagttcctgaagctgcaaaacgacctgaagtccctgaaaaacaaactgctcca
caagaagtaacaatgccagtgacgaagccacagcctgccgttaaggctgaagaaccaccc
aaagtggctccagaagagaagaaaccagctgtggtggaaaaaatatctccagttacagat
gaaaccaagggaccggtccaggcaccaggaggcgttcagaaagagggacaaccagcagag
gaagcaggaagaggtcgaggcagaggcctgaaacccaagcagaccccgtcccccggagag
ggcaggggtcgtggactaaggcctggtggcaggggtccaacacctcctgaggaaccattt
gcaggcttcaaacttaaagctgtccccctgaagttcatcaagaagcttcaggacattgtg
ctgcaggaggccgagtccatcggatcctctgctgtgttcgagtgcgaggtctcgccctcc
actgccatcacttcctggatgaaagacggcggtaacctgcgtgaaagtcccaaacataag
ttcacctctgatggcaaagaccgtaagctgcacatcattgatgtccagctgtctgacacc
ggtgaatacacctgcgtggcgaagaacgctggcaaggagattacgtgcaccgccaagctc
atagttgaagagcttcctgtaaaatggatcaaagaacttgaagaggagacatcagcaata
aagggccagccaatatacatgacctgtgagctgaacaaagagagagatgtggtctggaaa
aagaacggagaagtcctgaagaagaaggagggcaagattcagatcaacatcatcggcatg
cagcacgctgtgaccatccagaactccacagaagaggacgctggatgttactcttgtgaa
gtttctggacaggaagatgtcaagacctccacaaatgtcaaagtgatggaaattatcaaa
gactggatcgtgaaaccacttaaagaccagcatgtgaaaccaaaggccacagctgtcttt
aaatgtgagctcttcagagacactcccaactggaagtggctcaaaggagagaatgaagtg
attccatcagacaaggttgagatcgagatggatggcaaggtgctgactctgaccatcaag
aactgtcagccgaacgatgtagcagaatattccatggaagtggaaggacgtgtctacacg
gccaagctaactctaggagagcgcgaggctcagatcctgaagcccctggccagtgttgag
gtggtggagaagcaagatgccatgtttgagacggagatatctgaggacgatgttccagga
gaatggaaactcaaaggagaggttctgataagatctccgacctgcgacatccaaatggac
ggtacggtgcgtaggctcacgctgaagaactgtcagctggatcaggccggagaagtttct
taccaggctctgaacgccatcacaaccgccatgttgaatgtcagagagatcgaaatggac
tttgttgtcccgctgaaggacgtgtgtgtgcctgaaaagaaacaggctaagtttgaatgc
accatcacgaaggatgtcgctaaggtcatgtggtacaaaggggctgacatcatcacccct
gaccaaaagtacgacatcatcgatgatggaaagaagcatatgctggtcataaactgctgt
gagtttgatgatgaggatgaatatacgattgaagttttgggcaaaacttcaacagctaga
ctcacggtggagggtatcaggctcaaatttatctcgccgttaaaggaccagacggtaaag
gagggccaaacagctcgctttgagctggagttctcccacgacaacatccctgtcacctgg
tacaagaacgatgttaaaatccatccgagccggacggtcatcacccacgtggatggaaag
aaacatgtgctagaaataaaggatgtgactctagatgatatctgccaaattaaagccgag
gccaaaggaattccttccatggccaacctgacagttatagagggagatccttacttcaca
gtgaagctgcaggactatactgcagtggagaaagacaatgtggttctagactgtgagctc
agcaaagatgttgaagtcatgtggtaccacaacgaggctgagatcaaggccaccaagacg
gtggccgtcaaagcagagggcaaacgcagaactctggtcatcaggaaggttggggacaaa
gacaaaggacagtatgtatgcgactgtgggacagataagacaacagcaaagcttcacatt
gaagctcgccacatcaaggtggttcggcccatgtatggagctgaggtgttagaaggagag
acggctcggtttgaggtggagctcagtgaggatgatgttcacggccagtggaaactaaac
ggagaagtcctcaattcgtctgctgaagtggaaattgtggaggacggcgccaaacacact
ctggtgttgtataactgcaaagtgcctcagacaggcgagctggtgttcaccgccgccaac
gccaagtgttctgcgaacctgaaagtgaaggagcttcctgtctcgttcattacgccgctg
gctgacgtgcacgtgtacgaaaaggacgaggcaaggtttgagctggaaatttctcgagaa
cccaaaagtttccgttggctgaaaggaactcaggagttattgaacgacgacaaatttgag
atccaagttgatggcaatcgccacacccttattgtaaaatctgcccgatatgaagacgaa
gccaaatacatgtttgaggctgaagataagaggacgtctggaaaactggttattaaaggt
gtccgtcttgagtttatcaagccgattaaagacgtgactgtaaaggaacgtgaaactgca
gagttcagcgttgaactctctcatgaaaaaatcccggtagtgtggttcagcaacgatgtc
cggctgcaccccagtaaggtggtgcacatgtcagaggaaggaaaagtccacatgcttgcc
ttcaaggaggtcacgatcgatgacacctccatgattaaagtggaggccatgggaaagacg
tcagaggccatgctcactgttcttgagggcgacctctacttcacagtgaaactccagaac
tacaccgccgtcgaaaaggacgaggtggtcttgtcctgtgaactgagcaaggccggcgct
gaggtcaaatggttcaaagatgggaacgagatctttccatccaggaacgttctcttccag
tccgacggcaggaagcacatgttggtcatcaagagagcagcaaagaaagacatgggagtg
tacgcctgcaactgtggcaccgacaaaactaccgcagacctgaacattgaagaacgcgac
attaaggtgacgcgccccctgtacagtgtggaggtcacagagacagagacagccacgttt
gagacagagatttctgaggacgacctccacgccatctggaaactgaagggagagacactc
cacccgtccgctgatgtggagattaagggcgaaggagcccgacacacactgactctctac
aactgcaagatggacatggccggaagcgttgacttctcggcagcgaacgccaaatctaca
gctcagctcagggtcaaagcccgagtcatcggcctgatgaggcctctgaaggatgtgacc
gtgactgccggggagaccgccaccttcgagtgcgagctgtcatacgaaggcatcgctgtt
gagtggttcctggggggtacaaagctggaaccaagtgacagagtggtgctgaaggcagat
gggaaagtccacagcgtgacggtgagagacgtccagctgaatgaagctggacaagtcaaa
ctcaccgccaaggacttccagactgaagccagcctcttcgttaaagagccaccagtagag
ttcaccaaacctctggaggaccaaacggtggaggaggagtccaccgccacgctcgagtgt
gaagtttccagagagaacgcagaggtacaatggttcagggacgggcaggacatccgcaag
accaagaagtatgaaatgatcgtcgatggccgcaagagggcgctgctcatccacgagtgc
accctggacgactcaaggacttacacgtgtgatgccaaagacttcaaaacctcctgcttc
ctcaacgtagagcctcctcatgtcgagttctcgaagccgctccatgatgtcgaggtcaga
gagaaggaatctgcccggtttgaatgtgaagtctccagagaggacgtcaaggtccgctgg
tttaaagatggaagtgaaataagaaaaggaaagaaatatgaaattattgctcagggccgc
caacacatcctcatcattcacaagtctgtgtttgatgatgaagccgagtacgaatgtgac
gccaagacctccaaatcctccggcatgctcactgtcgttgaggaggaggccagattcacc
aagaacctgtccaacgtggaggggacggagacggacagcgtgaggctgatctgtgaggtc
tccaaacccagcgccgatgttatctggtaccgaggcgacgaggagctgcctgagggagga
cgctacgaccagatcgtcgacggcaagaggaggatcctcctcatccaggacctgaagacg
agcgacgccggagagtacaactgcaggctgagtcccaccgtcagaacctccggaaacctc
cagatcaacgaaatggctgctgagttcatctctaggcctcagaaccaggaagtggtggag
ggccagaaggcggagttcacctgctccgtctccaaggaaacctttgaggtgaagtggatg
aaagacaacaaggagctggaggcgggagacaagtaccagatggtgagcgacggcaagaag
cgaactctggtcatcaaggactgtgagctcaaagacgagggcgggtacgtggtggtgatt
ggagcgacgagagccagcgctgacctgaccgttcacgagaaactgaagatcatcacccct
ctgaaggacaccgagggtaaagaaggtcaggaggtggtcctgaactgtgaggtgaacact
gacggagccaaggccaagtggctgaagaatgaagagacactgtttgagagcggcaagtac
accatggtccagagagacaatgtcttctccctgaggatcaaagatgcccagaaaggagac
gaagccaactacagcatcaacctgaccaatcagagaggagaacaggctaagagctcctgc
agcctcaccgtcaaagaggagagtctgaggatcgtgattcctctggaggacatcgacacc
caggagaagaagaccatcagcttttcttgtaaggtcaacaggcccaacgccactctgaag
tggatgaaggccggcgaggagattgccctcagcaaacgattcgtctacagggtggataaa
gaaaaacacacactgaccatcaaagactgtacgctggccgatgagggcgagtacactgcc
gtggcaggagacaacaagtccaccgcagagctgatcatcagcgaggcgccgactgacttc
agcatgaacctcaaggatcaaaccatcacagagttcgacgacgccgagttcacgtgcaag
ctgaccaaagagaaagctgatgtgaagtggtacaggaatggacgggagatcagagaagga
cccagatacacttttgagaaggatggaaagttttgcactttgcgtatcaaggagtgcaga
cctgatgacgagtgtgaatacgcctgtggtgtggacgagaagaggtcccgagccaggctc
tttgttgaagagacgccggtggagatcgtccgaccgccgcaggacgtgttcgaacctcct
ggctctgatgtgttgttcgaggtggagctgaacaaggaccgggtggaggtgaagtggtta
aggaacaacatgacgatcgtccagggagacaagttccagatggttagcgagggcaaagtt
caccggctgcaggtgtgtgagatcagacccagagaccagggagagtaccgggtcgtcgcc
aaggacaaagacgccaaggccaagctggagctggcagccgttcctcagataaaaaccacc
gaccagagctacgtcactgacgccgggaagcccatcgtcatggccgtcccctacagcgcc
taccctcgggccgatgccgactggctctacgacaaccagagtctgtccaaagaccagatc
cacacctccgcagaccgcacagagtaccggctcaaggaccccaaaaagtcagacgaaggc
cgctacaagatcaccatcaagaacaaacacggagaaggagaagcgttcatccacctgagc
gtcatcgatgttcctggacctgtgaagaacctgcaggtgattgacactgctgacggtgag
gtcagtttggcgtgggaggaaccagaaaacgatggaggcagtaaagttatcggatatgtt
gtggagagacgcgacgtgaagcgtaagacatggactctggccaccgaccacgctgagagc
ccagagtacacggtgaccgggctacagaaggactccttttacctgttcagagtctgcgca
cggaaccgagtcggcagcggaccccttgttgagaccgacaaagctgtgcaagcaaagaac
aagtttgatgttcctgaagctcctctgaatgtcattgtgggaaatgtctccaagttcggc
tgcaccgtctcctgggagcctcctgagtctgacggaggctctcccatcatctcgtacatc
gtggagctgcgtgacaggacgtccgtgaagtggtcgcctgtccaggtgaccaaagccgac
gagctcagcgccatcatcaacgacgtcattgagaacaaggagtacatcttcagggtcaaa
gctgagaacaaagctggcgagggcaagcccagcgccgcctcacaacccgtcaagattatg
gatcccattgagcgtcccagtccacctctgaacctgacctggcaggaccagaacaagagc
tcggtgcagctcagctgggagactcccctgaagaacggaggcagcatgatcactggatac
atcatcgaacgctgcgaggacggcaccgacaagtggcttcgctgcaatgcccgcctctgc
cccgacctcttctacaaggtgtccggtctgaaatatggaaccaagtacaactacagagta
tttgctgaaaatgctgctggcatttcggacccgtccaacaccatcgggcctctgctggcc
gacgacccacacgttggtccgacctttgacctgagcgctttcaaagatggccttgaggtg
atcgtccctcagcctcttgttatcagagtccccatctctggatacccaacccccgtcgcc
aagtggaccttcggagagaaggagttgagcaccgcagacgagcgggtctgcctgatgacc
aagtccacattcacagagctcagcatcgctccgagcgtccgacccgacaaaggcatttat
accctgcagctggagaacgatgttaccaccgtctctggagagatcgaagtcaatgtcatc
gcggcacctagtgctccgaaggactttaaggtcctggaggtgacccgacagcacgtccac
ctgagctgggaggctccggagcacgacggaggaagtcctctgaccggatatcaggtggag
aaacgggacgtgtcccgcaagacctgggtcaaggttgtcacggggatccaggatcaggag
ttcaccgtcaccgacgtggttgaagggaaggagtatctgttcagagtcactgcgctcaac
aaatgtggcccaggagagccagcgtacatcgatgagcctgttaatgtctcctcaccagcc
actgtcccagaccctccagagaacctgaagtggagagacaagtctgccagtggcatcttc
ctgacctgggagccgcccaagtatgatggcggcactggcatccgaggctacaacgtggaa
cgctgccagagaggaacagataaatgggaaccctgcggagacatggttcctgagctgaaa
tgccaggtgactggtctgatcgagggccagtggtacgcatacagagtccgagccctgaac
cgacttggagccagccggccctgcaaggccactgatgagattcaagctgtggatcccaaa
gaggctccacagatccatctggatgccaagctgctggctggtctgactgccaaagctggc
agcaagatcgaactccctgctgaggtgaccggtaaacctgaacccaaagtaaagtggacc
aaagccgacctggtcctcaaaacagacgacagggtgtccattgacaccaaaccaggacac
tccactgttactgttgccaagaccaagagagacgacagctccacctacatcatcgaggct
accaacagcagcggccgtgccaccgccactgtggacgtcaacatcctcgataagcctggt
cctcctgctgcctttgacatttctgatatcaccaatgaaacctgtttcctggcctggaat
cccccccgtgatgatggcggctctagggtcacaaactacatcgtggaacgccgggccgtc
gacagtgagatctggcaccggctgtcctccaccatcaaacagaccacatacaaagctgtg
ggtctggtcaagttcaaagagtacatcttcagagtgtttgctgagaaccagtttggtgtc
ggtcccccggctgaacacccatccatcattgccagataccccttcgacactcctggagct
ccctacaagctggagccttcagacattgccaaggactctctgactctgacctggtacgag
ccagaggaggatggaggaagtccgatcacaggatactgggtggagagatacgaaccggac
cacgacaggtggctccgctgcaacaagctgcccatcaaagacaccaactacagagtcaaa
ggtcttcctaccagaaagaagtacaagttcagagtcctggctgagaatttagctggaact
ggaaaacccagcaaagaaacagatccaatccttgttaaggatccaattgatcctccatgg
cctcctggtaaacccacagtgaaggatgtagctaagacttcctgcttcctgatgtggacc
aaacctgagcatgacggtggagccaagatcgacagctacatcattgagatgttgaagagc
ggaaccacagactggattcgagtggcagagaacatcaatttcttggagtttttcctgaag
ggcctgatggagaagcaggagtattccttcagagtgcgagctgttaacgtggctggagag
agcgaacccagcgagcccagcgacccggtgctttgcaaagagagactgaaccctccctcg
gctcctcgctggttggaggttgtgagcatcagcaggaacagcgccgagctgaagtggacg
gccccggagcgggacggaggatccaaagtcaccaactatgtggtggagaagcgtgacgtc
aggcgtaaaggctggcaggctgtggataccacagtcaaggagctgaagaccaccgtgacg
cccctgaacgatgggtcgctctacgtgttccgtgttgctgcagagaacgctgttggcgtt
ggaccgttctgtgagctggaggactctgtgttggccaaagatactttcacaactcctggg
ccaccatatgcactcactgtcaacactgtgaccaaaaaatacgtggacctagagtgggag
gcgcctaaaaacgatggtggcagacccatactcaggtactccattgaaaagaaagagaaa
cttggaacacgctgggtgaaatgtgccaagacttcaggcccggactgtaagtacagagta
acagacgtcatcgagggaacagaggttcagttccaggtccgcgctgagaacgaggctggt
gttggacatccgtgcgaacctactgagatcctgaccatcgaagatccaacaggcatcccg
tctccacccattgagcttcatgtgactggagccagccgagacttcctgtccatcgcctgg
aagcctccacaacaggatggcggctctcccatccgtggataccacatcgagatgtgtgag
gctggaacagagaagtggatgagggtcaactcccgtccagtgaaggagctgaagtaccgc
gtggaggagggtgtggtccctgagaaggagtacatcctgagagtgagggccatcaatgct
gttggagagagcgagccctccgatatctccgaaaacgtctttgccaaggactcagactgt
aaccccacgatggacttccagactctggacttggttgttgtggaaacagagaagcttcac
attcctgtccccttcagagctgtgccctcacccagaatcacctggcataaggatggcaag
gagctgaaggccgatgaacgtattggcttcaggaaggagtacacttcctgtcacctggag
attgacagcagtgttcatcctgatgctggagtttataaagtgaccctggagaacacgctg
ggaagtgccagtgccaccatcaatgttaaagtcatcgggcttcctggtccctgcaaggag
attgtggcttctgagatcacaaagagctcctgtaaagtgtcctgggatcctccagactat
gacggcggcagcccgatccttcactacatcctgcagcgccgtgaggctggcaggaggaca
tatgtcaacatgatgtctggagagaacaaaatgtgctggaccgtgaaggacctcatcccc
aatggagagtactacttcagagtccaagctgtcaacaaaattggaggaggagagttcatt
gagctgcgcaacccagtcattgctgaggaccaaaaacattctcccgaccctccagtggat
gtggagacccacaacccttcatccagcaccatcaccctgacatggaagcctccgatgtac
gatggcggtgccaagatcatgggctacattctggagaagcagcagaagggcgaagacaag
tgggagaggtgcaacgatttcctggttcctgtcctgtcctacaccgtcagaggactgact
gaagggaagaactacacgttccgagtcaaagccgagaacgctgccggcatcagtgagccg
tcacggaacacgccttttgttaaagcctcagacactattgatcctccaaaggtattcctg
agcggcagtctgcagtctggtctcagtgtgaagcgaggctgtgagatctgcctggacgcc
aacatctccggctcgccataccctcagatcacctggtactggaacaaccgggagatccaa
cctgaaccactccgcaagaggcctgaaaaacccctgaagaagaaggcagagaagaaggaa
gagcagaagaaagaggaagaaaaggaggagaagaaggctgagggagaagcagaggagaag
aaggagggagaggtgaaggagggagaggagaagaaagaaggagaggagaaaaaagaggag
gagaagaagccagaggaggaagctgaagaggtggaggagcccgactatccaaccatcaat
gaacgtctgaccatcaacaacagtcgaaggggtgtgtcctccatcctcattgtggactcc
gtccgccgtgatcacggcgtctacatggtgaaggtggagaacgaccacggtgttgcctct
gcaacatgcgaggtcaacgtactcgatactcctggtcctcctgtcaactttaagtttgag
gaggtcaggaagaactctgttatctgtaagtgggatcctcctctggatgacggtggcagt
gaggtcatcaactacaccctggagaagaaggacaactcaaagctggagttcggctggagc
tcggttacctccaccctgatagggtgccgctacctggtgcctaaactcatcgagaagaag
gagtacatcttcaaggtcatggcagagaacaagtttggccctggtccaccctgtgtctcc
aagcctctcattgccaagaactcttttgaacctcccgaggctcccgataagccacaggtt
gatgacgtcacatccaacagcatgctggtcacttggaatgaacccaatgacaacggcagc
cccatcctgggatactgggtggagcgccgggagatcaacagctcccactgggcgcgtgcc
aacaggaacattgccccaagtactgagctgaatgttgaagggctgctggagggactgtct
tacatcttcagggtggcagctgaaaaccaggctggacccggaaagttcagtcttccctct
gaacccaaaatggcccaggctcgcatcttgcctcctggacctcccattgctcgggttgca
acaaccactgaccactcgattgaagtggaatgggacccacccgctgataatggtggaggg
gagatcctgggataccacgtggacaaggcaatggctggtagcaaggactggtccagatct
actgaacgcccctggaagaaccgtgccttcaccgtgtatggagtccgtgagggagccaag
tacgcagtcagagtcatcgcttgcaatgctgcaggagaaggaacacctggattcacagag
gctgtgtttgtccgaaatccagcagaaaagccagtgatagagctggacctgtctgtgaag
aatggtgtcatcatcagagctggagaaacactccttgtacctgctacagtcacaggtaaa
ccttacccagccatcacttggaccaaggatgatggtaaacctgacaaagaccgtgtggag
atcctcagtgagggcaacaacagcattctgtccatcaataatgtccagaggaatgactgt
ggaaaatatcagatctccgctttcaaccccagcggcaccaagtctgcctggaccagagtg
gaagtgatggatgtccctggacctgtcacggatctgaagccagttgttgttacccgtaaa
atgatcttcctgaactgggacgaccctgtagatgacgggggcagtgatctgacgggcttc
cttgtggaacgcagagatatcaaggggcacacatggagacagcctgttgaaactatctca
tctaagtgtgagtgtgtgggtatcatggagggacaggagtacatcttcagagtcaccgcc
aagaacaagtatggtctgggtgtacctgtggaactgccaccgatcaaggctatagaccca
cagggtccaccatcataccctgagaagttccactatacagaacgcaccaaggactccatc
acactatcctggaagcctcctcgtaacgatggtggcagtcctgttattgggtactttgtt
gagaagaagagacaggaccagcaggcctttgagccctgcaacacagagatctgccctgac
atgactatgactgtgaacggcctggaagaggcctggatgtatgaattcagaatcaaatgc
gccaatctgattggagagagtgagccatccatcccaatgactgtggttatccaagatgat
gaagtgtctcctgaggtccacatgctgaagcactttaaggcagactgtatcatagtgaag
aagggtgagcctattgagattcctgctgacatcatcggactccccgtcccaaagattgag
tggtccaaggatgatgtggtgattgccaaatccactgaggcccttctaattgagacagag
gttaccggcaggatgaatgccaaaaccaagctgtctatcccagctaccaataggagggac
cggggcagctacatggtgttagcttccaacaacatgggcactgccaaacacactatcact
gtcatggtgctggaccgaccaactccagccagaaatctgactgtgtccaacatcagggca
gagtcttgctacctgaactgggacccgcccactgataatggtggcagtgaagtgaccagc
tacattgttgagaaaaaggaagtgatgaaagagcagcctgagctggaggagggagagaag
gctccacctgagccacagtgggaagaagtcaacagcagtgttattgacaggaaattcggg
gtgtggaacctggagaccaataagacctacctgttccgagtcaaagcacagaaccgttac
ggtatatccgatccttgttcaacagaagaggttctcatcattgaccccttcggccttcct
ggcccaccagagaaaccgactattgcagaatactccaagacctccatgacactaacctgg
gagcctcccagagagaccggaggatcaaagattaacggctactggctggagaaacgggag
aaaggcacagattactgggctaaagtcaataagatgccagtaactaaaaggggcatgaaa
ggctgggagtatcaggtgactcgtctctttgaaggaacagagtacgagttcagggttgca
gcttttaattcagctggaaccggacctttcagtggaccttctgactctgcctttgctgtt
gatcccatcactcctcccagcatgcctgctgctcctgtagttgctgataagaccaagtac
aacgtcacactgacctggaaaccacctgagagcgacggaggaagccccatcaagggttac
attgttcagattcaggatgagggctcgtcagagtggcacaaactgaacgatattgacagc
ctgcaccccaccacagagtttgtcgtgcccagtctccgcgagctgaaacgctaccggttc
aggatcatcgctgtcaatgacattggagagtctgagcccagcccccgcaccagcgaagtt
ctgattgaggatgttcaactaccacctttcatcacgatcgatgtactggctgaagaactg
gtaaatattcgcgctggagatccaatcaggatacccgccaccatcaaaggccgccctgtt
cccaaggttacctgggactttgaaggcaaagctaagatggagaagaagaacaaactgcat
acactgccggtggactctacggttgagtccacggacaccacatctgtggtgaacatcccc
gtcagcctaaggagccattctggacgttacactatcaccgctaagaacaagtcggggcag
aaacacgtcaatgtcagagtcattgttcttgatgttcctggacctccaaaggacttgaag
gtcactgatattactcgttcaacaatgaggctgatctggaaactccctgatactgatgga
ggagaaagaatcaagagctacttcattgagaagaagtctgtcattgacaaggcctggacc
aaggtgaatgcagcctgtgctagccaggcatttgtggttccaggtctgttggagggtcag
gactacctgttcagggtgcgagcagagaacagactaggattcggcccgttcactgaaaca
accgaacccattcgatccagagatcccatctacccacctgaccccccaaccaagctgaag
gtcaacctggtaacaaagaacacggtcaccctgagctgggaaccgccaaaaaacaatggc
ggctctcctgtgaagcattacatcattgagcgtttgagctgggacacgagtgggaaggaa
aaggagacctggaagcagtgcaacaagagagacgtggaggagctcaccttcgtggtggag
gacctgaaggagggaggagaatatgaattcagagtaaaagctgtgaacgatgcaggaccc
agccgaccctctgccaccgtaggacccctggtcatcaaggatcagacatgtcctccaacc
atcgggctgcgtgaggccatggagggagaggagggatgtgatctcagcatcgtggcaaag
atcagcggctgcccgttcccgacgcttacctggcataaggccagtctggctaaacctgag
gagaaagctgctgtcaagtatgaccagcacttcaacaaactggtcactcaggacaagtgt
acgctgttgatccaacaggccaacaggcacgacagcgccctctacagtctgacggccagc
aacagtctcggctctgtcaccaaggacatcaaattattagtattgggacctccgggcgcg
cctgttggaccaataaagttaactgaagtttttgcggacagaatcggcctggcctggaac
cctcccacagacgatggtggatccaagatcacaaactacgtagttgagaagcgtgaggac
aacagaaagtcctgggtccatgtctctaatgaccccaaagagtgcgcctatgtggtgaca
cgcctcactgagaaccacgagtacgagttcagagtcatggctcagaacaagtttggagtc
gggccaccgatagtcagcgagcctgagaaggccagaaaccttttcaccgtcccgggtcag
tgtgagaaaccaacagtaactgaggtctgtctggagtccatgaccgtcaactgggaagag
cccaagtatgacggtggatcccccattaccggctactttgtagaaaagaaggagaccacc
tccaagcgctggacccgtgtcagccgcgagccaattcgagcgctcccgttgggcaacaac
tgggacgtcacgggcctgctggagggcgccttgtaccagttcagagtcattgctgtcaat
gctgctggctgcggtctgcccagcatgccctcagaccccatcctctgcagagaccccatc
aagcctccaggcccaccctcccctaaggtgacagactggacaaagtccacggtggagcta
cagtggctccctcctctgatagatggaggatcgaaggtgacgggctacattgttgagttt
aaagagataaataaggagttggaggagaagaaagctcagaggaggctgctgctgagtgac
gctgaggaggagaaggagcctgagggcgacgaaggctggcagaaggcgaaggacactgag
atcagaggaactaagtttgtggtgcccggtctgaaggaaggcggtctgtaccagttcaga
gtccgagccgtgaatgctgctggggtgggagacccgggacttgtgttggagctgatcgag
gtcaaagacagaacaattgctcctgagatggacttggatgcctcggtgaaggagaagatt
gtggtccacgctggcggcaccatccgcatcattgcctacgtgtctggtaaacctgccccg
cagatcacttggtgccgggacgacggcgaggtgcccaaagaggcagtggtggaaacaaca
ggaatctcaaactctctggtgatcaagaactgcaaacgccaacaccagggcatgtatacg
ctgagcgccaagaacgaaggaggcgagaggaagaaggctgtcattgttgaggtgctcgat
gtccctggaccagttggtcttcccttcaccggtgagaacctgaccacagactcctgcaag
ctgacctggtactctcctgaggacgacggaggctcagccatcactaactacatcatcgag
aagcgggagtccgatcgcatgggctggacctcagtgtcctacacggtgacaaggaacaac
gcggtggtgcagggactcattgagggcaagggctacttcttcaggattgcagctgagaac
attatcgggatgggacctttcatcgaaatcgaaaagatggttcttatcaaagacccgatc
tctgtcccggagcgtccagaagacctgatcatcaccgctgttaccaaggactcagtctct
gttgcctggagaccaccaaagtatgatggcggcgccgaggtgactgcatatgtcctggag
tcccgaatgatcggccgggacaatttcacacggataggtggtgaggacaagctgatggac
aggaagttcacgctgaaggagctgaaggaaggctccagtcacgagttcagggtctctgct
gtcaaccaggtgggacagggcaagcactccttccccaccaaacctgtgcagtgcaaggac
gagctcgaaccacctactttggacctggacttcagggacaagatgatggtgaaggtggga
gacccgtgtttgctgtcaggacgctacggcggcaaaccgaccccagtcatcgcttggaag
aaaaacgatgaagagctgaaagcggacgacgagatcagccttcacagcaccacccatcac
ctcaacctgaacattagcaaagccaagagggatcacagcggcctctacgctgtcagcgtg
gagaacgccgccggtacccgtacaggaacctgcaccatcactgtggtcgatcgtcctcaa
ccaccacagggccccgttgtgtttaacgaggtctacaggaactacatggtgatctcctgg
aaccctcctctggacgatggaggctgtgctgtctccaactacatcgttgagaagagggac
actaacagagacctgtggatgccggtcatctcgtcctgcaccaggaccacctgccgggtg
ccaaaactgattgaaggccgcgagtacatcatccgaatcatggctcagaacatgtacggc
atcagcgaccccctcctgtcagcagagaccaaagctagagacgtcttcaaggttcctgat
gctccaaagcagcccgtgttgaaggaggtttaccaagactcggccctgatcagctgggaa
ccaccggctgatggaggaaaaccgatcacaggctacatcgtggagaggaaggagaccaag
gccaacaggtgggttcgctgcaacacagaaagaatccatcccaaaatggagtacctggtg
acagaactgctgaaaggctgcgagtacgagttcagagtcagtgctgagaatgaggtggga
gccggagatcccagcccaccatccaaaccagtttttgccaaggatcccattgtgaaaccg
ggtccaccggtcaaccttcaagccattgacttcaccaaggaatctgtgactctgtcctgg
gacccgcctactgacaccggcagaggaaagatctttggatacctgctggagttccagaag
gctggagaagaggaatggcacaaggtgaaccagactccagactcctgccaggagacaaag
tttaaggtgatcaacctggaggatggcgctctgtaccgcttcaaagtcatggctgtgaat
gctgcaggagagtctgacccagccaatgtcaaggagccaatcagagtgcaggacagactt
gagccaccggagctcatcctggatgcatcgatgacccgtgaagtgaaggccagggccggc
actcacatcacactgatggctgccatcaaaggtgtcccattccccactgtcacctggaag
aagaacgagggagaagttcccactagagccgacatcgagaccaaccaggcaggcaccaag
ctggagatgagattctgtcaccgtggtgactgtggagactacacccttacagtggaaaac
ccagccggatccaagaccgctacctgcactgttctggttcttgacaaacctggtcccatt
cagcacctccgggtgtcagatgtcagaagtgactctgcctacctgtcgtggaaggatcca
gaagacaacggcggcactcgcatcactaactttgtggtagagaagaaagacacagcatcc
actcagtgggtccctgtatgctctacgtccaagaagcgcagcatgatgttgaagcacctg
atggaaggaacctcctacacattcagagtcgctgcagagaatcagtacggccgaagtgaa
tatgttgagacgccaaaagccatcaaggcaatgaaccctctcttccctcctggtcctccc
aaagatctgcatcattctgacgtggacaaaaccgaggtgtggttggcctggaactggcct
gaccgcaacggaggaagtgagatcacaggcttcctggtggagtatcaagaagagggagca
agggagtgggaagaatggaagactgagagcattcctgagagccatgtcactggcctggag
gagggaaagacctatcgttttagagtgagagctgaaaacgccattggcctcagcagacct
gacaccaccctgcccatcctgtgtcaggagaaacttgtgcccccaatcgtcgaggtggat
gttaaatacattgaaggcatcattgtgaaggccggcaccaccatcaggttgccagctata
atgagaggaatccctgtgccaacagctaagtggtccattgatggagaggagatcacaagc
cagggcaaaattaagatcgacactgataatttctccactgtcctcagtattaatgagtgt
accaggaaccacacaggcacctacctgctgactgtgtccaatccagcaggaaccaagact
gtggccctgaatgtcacagttctagatgttccagctgctcctattggacccgtcaacatc
ctggaggtcactccagactccatgataattgaatggcgccctccaaaggatgatggtgga
agccccgttaccaactacattgtggaaaaaagagaatccaacaaggagacctggggagga
gtcagctctggccttcttaccactcagctcaagatcacccgactgcagaagggagcggag
tatgtggtccgcattcgtgctgagaacaaaatgggggctggcgttccactggaaagcaag
ccaaccgttgctgagcacaccttcatgccacccagtccacctggtaagcctcagtgctct
gatcttgcagaagatgccgttacagttggatggacaatgcctctagctgatggtggcagt
ccaatcactggctacctcattgagcgcaggcacatgggagggaagtggatccgtgtcaac
aagataccctgcaaggacctgcgctacagaatccagggtctttttgagggaagtgaatat
gaattcagagtgtttgctgaaaatattgctggctacagtggaccttctcccatctctgac
ccctgcaagccctgcagacccatcacagtcccaagtcctccaataaaccccaaagttaaa
gattacagtaagactactgctgacctggtctggataaaacctagcagagatggaggaagc
cctatccttggctacactgtggagatgcagaaagctgattctgaggaatggaagaaatta
aatctggatgatgacttcattaagctgtgtgccttcagggtgaagggcctggaagagggt
gtgacctacagattcagagtccgagcttcaaacatgatcggtgatggagagcccagagaa
atcccaggttctatcactgctcaggatatcctcatccctccagagatagaaatggaggct
acttgccgtgagcgagtcactgtgcgtgttggacacaacatcaacatattcggctacatc
aaggctcgccctgatcccgaggtcatttggtcaaaggaggacacagttctggagaacagc
aagcgtgttaccctagttcagaacttgcctatggtccacctgaggataaaggaagccaca
aggaatgaccatggcaaatacacactgaaggcttcaaatgtgggcggtgaggcatcctgc
accatcacagttaatgtcctggacagacctggtcactgccagaacctgcacctcacctat
gtcaccaaagcctcctgtatgatcaactgggaagcacctgatgacaatggtggatctgaa
atcaccaactacattgtggagtgtcgtgagcccagcatcagtgggtggtctatgatctcc
tcaaactgcactaaccgaaagatcaaagccaagctgatggaaggccatgagtacctgttc
cgtgtctgtgctgtgaacaagttaggacctggtcctgctgtggagctcaagtcccctctg
ctggccatagatcccatcgagaagcctggagagccggagaactttagagccactgacatt
ggtaagaactttgtctacctgaggtggaggaagcctgactatgatggtggcagccctaac
ctctcctacaacctggagtacaaagccaaagatgctgaacagtgggagaaactcaacaaa
ggcatgctaacagacaccttcttcttggctgataagtgtgtggagaaccagacatatagc
ttcagggtccagactgtgaatgagggaggagaaagtgcctgggtgaaacttcctgatatc
ttggtaaaggaggagctccagaagccagtcattgacctgaaggtggctggaactgtgacg
gtgatggctggagagtccgtcaggatggaggctgccctgagaggaaagcctcagccagag
gtcatatgggtcaaagacaaggctgtgggaaacaacccgagactgagctatgaaaccggt
ccagactattccaagttccttttgactaagtccaagcgcacagacactggaaagtatatc
atcactgccaccaacacagccggcaccttcacagcatatgccaatgtgaatgtcctggat
gtccctggaccggtgaggaacctgaggatcaccggcatcggagctgacaagtgcagagtg
gtgtgggacggcccagaggacgatggaggttgtgaagtagacagctacattgtggagaaa
tgcgagaccaggaggatggtgtggtccacgtactcggctgctgtggtcacaccgtactgt
aatgtcactcgcctggtggagggtaacgagtacatcttcagggtgagggcagagaataag
atgggaactggccctgccatggagagcaaacctgtaactgtgaagacccagtttaacaga
cctggacctcctgaggcccctgaagttaccaaggtgagcaaagatgagatgactgtggtc
tgggctccaccggagaacgatggaggaaagtccatcaccggctacatactggagaggaaa
gagaagcgggcggtgcggtgggtgccgtgcacaaagagccccatttctgagagacgtatg
aaagtcactaacctgatcccaaaccacgagtaccagttcagagtgaaagctgaaaatgaa
gttggcctgggagagccaagcaagccctgcagacctgtggcagccaaagatcctatcgaa
ccacctggtccacctgcaagcctgaaggtgggtgacagcaccaagacctcaataaccctg
acctggtccaaacctgtgtatgatggtggtgctcccatcatcggctacagcctggacctg
aggctgaagagcgaggcggaccctgagaaaccctcagagggctggaagaggatcgatact
cgtggtccactggtgatcacggagttcactattggtcagctggatgagaagcaggagtac
gagtttaaggtttctgcccagaaccaggtgggctggggccgccacgcctacctgaaggaa
gccgtgtctcccagggagattctggaggctccagaaattgacctggatgctagtctgagg
aaaggcctggctgtcagggcaggctgtccaatcaggctgtttgctgtgatcagaggaagg
cccgcccccaaggtcacctggaagcgcatgggcgtagacaatgtggttcgccgaggacat
gtggaccaggtggacaccatgtccttcctggtcatccctgagagcaccagagaggattct
gggagatattcactgactctgtccaactcagctggagaaaaagctgtgtttgttcgtgtc
aaagtcctcgacactcctggtcccgttggagacttggatgcaactaacgtcactaagacc
accgctcagctctcctggttgccaccagaaaatgatggaggcagccccattctttattac
atcgtggagaaacgggaggtggacagaaagacttggagcaaatgcatagaggacctgaag
aaaaccagcttcaaggtgaccaatctggcacctggcattgagtactacttcagagtcatg
gcctgcaacaaatatggcattggagttcctcaggattctcccagatcctacttagctgtg
gaccctcttagtgagccagaccctccaaagaagatggatgtgttggagatcaccaagaac
agtgccaccctgggctggctgaagccccttagagatggaggagccaagatcaatggctat
gtggtggattatcaggaggaaggtgcacctgagaacaagtggactccttactccgtggtc
aaagatctgaccatcgtggtggtaggtctgaaggaaggaaagaagtaccggttcagagtg
gcagccaggaactcggtgggagtcagcttggctcgagaggctgagggaatgtttgaggtc
aaggagcagctgatggctccaaagatcatattgcctgacattgtgacggccagagctgga
tccaagatggtgattgaggccattgtggcgggtaaacctgctcctgtctgcaagtggaag
cagggcaatgaggacgtgctgacctctgaccgtctgtcacttgcaaagacactgacaacc
tgcttactcatcatcaagaatgtgaacaggaaggacagcggctactacagtctgtcagct
gagaacacctccggcaaggtcaaccagatcctcagggttatcatcatggacaagcctggg
cctccagaagctccattagaaatcaccgagttggacattgatgcctgcacactgctctgg
aacactccacaggaagatggtggcagcaacatcaccaactacattgtggagaaatgtgat
gtcagccaaggggactggatcactgtatcagcttcctgcactaagaccagtttcagaatg
accaaactcactactggaagagagtatgggttcagggtccgtgctgagaacaggttcggc
atctcagaacccatctactctgagaagatggttgccaagtatccatttgatcctccgagt
gagcccagaaacctggagattaacaaggtcaacaaggactttgttatcctgtcctgggag
cgtcccagcagcgatggtggcagtcccatcactggttactgtatcgagaagaaggagagg
aacagccttctgtgggtgaaggctaacgaggctgtggtcaaagcaacccagtatacctgc
atgggcctgatcgagggtctggagtataccttcagggtgtcggcatataaccaagcagga
cagggcaaaccgtgcaaacacaccgacttcatcaccgccaggactgccgttgactcacca
ggtaaacctgagcccatggatgtgaccaagaactctgtttcattggtttggaaccgtcct
aaacatgatggcggcagcaagctgattggttactacatggaatatgcaaagctcccagag
gagaagtggacccgctgcaatgccaactgcatgaacatccagacagaagactatgtggta
cacggactggaggagggtcaaaagtaccagttcagggttattgccaagactgcagtcagc
atcagccttccgtctgagctgtctgatcccatcactatcatagcagagaacgttcctcct
cgtgtagaactcggcgtcaacatgaaaaaccttattgtggtaaaggctggagagaacatc
ttcctggatgcagaggtttttggtaaaccactgcccaaggtgggctggaagaaagacggt
gcacccctggtcctcaccgagggaatgaaggtaactcagaagaaacatgttcatctgctg
gagctctactccgtcaccaggaaggagtctggagactacaccatcacagctgaaaatgtc
aatggctccaaatatgctaccataaaggtcaaggtgcttgacaaacctggacctccagcc
tctgtgaaaatctttaaggtgtttgctgaccatgtcaagatgcgatgggagccccctctt
gcagatggaggatctgaaattacgaactacattattgagaagcgtgaaaccagcagggcc
aactgggcgctggtaacctccaatatccatggccacaacactgactgctcagtggagaaa
ctcatcgagggtcatgaataccagttcagagtcagtgctgagaaccagtatggtgtggga
gatcccatcatgactgatgccatcttggtcaagaacccatatgatgttcctgggccatgc
gagcctcctgtcatcaccaacgttaccaaggactccatgacggtcagctggaaagctcca
gccaatgacggcaaagctcccattctgggctacatggtggagaagcgtgaggccaccgag
ctgacctgggcaaaggttaatcgccgaccagtcattgacagaaccatcaaggccattcag
ctgactgagggctctgagtatgagttcagaatcatagccctgaacaaggctggtctgggt
aaacccagtgatccatccaatgctgttctggctattgaccccgtctatcctcctggccca
cctgcattccccaaggtggtggactctaccaagaactcggtgagcctcagctggaccaaa
ccagcgtacgacggtggctgtgagatcattgggtatctggtggagtacaagcgagctgac
attgaaggctgggctacctgcaacgtcccaaagaaactccaggccactaagtttgtggta
actgggctgatggaaaacacagagtaccagtttagagtcaccgctgtcaacaggatcggc
tacagtgaacccagcgaggttcctggaaaccacatggccaaggacatcctgatctcccct
gaagctgagctggatgctgacctgaggaaggctcttgtgctgcgagccggcatcaccatg
aggctctatgtccctctgagaggacgaccggcacctaaggtgacatggacaaaggtggat
gccaacctgaaggaaaggcagggcattctgatcaagacatcagactgggacaccctactg
atggtagagaacataaacagatacgacgctggcaaatatgtcctgtccctggagaacagc
agcggatccaagagctacaccatcgttgtgaaggttctagattcacctggaccacctgtc
aacctgattgtgaaggagacctccagaacccacgcctgcatcacctgggatgcacctctg
attgacggtggcagcccagtgaagagctacattgtagagaaacgtttggcagagaggaag
gcatggacctgtgtgtcagcagagtgccacaagccctcattcaggatcaccaacctggag
ccgggacaagcgtactgcttcagagtgctggctgaaaacgcctacggcatcggagagggc
tgcgagactgcgggcagcgttcgggcatcagaacaacctggtccagtgacagacttcaaa
gccctgaagaccaccaagaactcaatcactttgggatggaagaagcccatcagtgacggt
ggaagctatgttaccgcgtacatactggagcagagcgaaggcgaggagaagtggacacag
ataatgaagggcaagaacatgtcacacaccatcagtgagctgacagagggcaaggcatat
ctattcaaggtcaaggcgctcaatgagtctggagagggaccaccaactgagctcactgtt
gccgccaaggaccagtttgtgctgcctgactgcaacttgagcaatctgcatgatggttgc
tacgtggtaaaagagggcaccaccacacgtatcaacattcctgttattggagtgccctac
cccactgccacctggaagaagggcgaggtggggctcggtgatactggccgtgtatgcatt
gaggcttcaccgggtgtcaccaccctgctgatcagggactgccatagaggagatgctgac
acttacactatcaatgttaagaacagcgctggctccaaagactgtaagttccagttgaag
gtagtcggaaagcctggcatctgcaccgcacccataaagtttgacgagattactgctgat
ggcattactctggaatgggagccaccccaagacgacggaggtgcagaagtgtccaattac
atcgttgagaagaggaggacaacagacaacaagtgggccacagtggcttcagccatccag
aagaccaccatgagagtgatcagactccatgatggaatagagtacatctttagagtttgt
gctgagaacaagtatgggattggagagtttctgaggtctgacccagtcattgcccagcat
ccattcaatgtacctgaggcgcctgctcctccagagattgtaagcatccgccacgagtca
gctattctgacatgggctgatccaaaagacaccggtggctccccaattactggatatcac
atggagtttaaggaaaggaacagcctgatgtggaaacgagccagcaagactcctctgaga
gtgaaggagtgcagagtcacaggtctaatagaggggctagagtacgagttcagggtgatg
gccatgaatatggctggccttggaaaggcaagtaaggtcacagaagcagtggctgccctt
gatcctattgatccacctggcaaacctgaagtgattaatgtgaccaggaacacggtcact
ctggtttggactgctcccaaatacgatggtggctataagctgactggctatgcggtagag
aagctagaggctggtggcaagacctggatgaaggcgaatcatgtcaacatccatagctgt
gccttcaccgtcactgacctgatggaaggatctcaatttcagttcagaatcagggccaga
aacgctgctggtgctctcagcattccttcagaatgtactgagtctctgacctgcaaggat
gagtacgagcccccatctatcactattgaccaagacatgaaggatggtgtatcagtcagg
gcaggagacacaattgtgatctcagcctctaagattgtgggtaaacctccaccaactgct
gtctggtccaaaggcggtcgtgagttcaagaactctgacacagtcactgttaccagtacc
cctacttcttccaccctggctattaagtatgcaagctggaagaacacaggagagtacacc
atcactgctagcaacccttttggtattaaggaagaacatattagagtgaaagtcctagac
atccctgggcctccaggtccgattgaagtcagcaatatttcagctgagaagtgtactctg
acctggcttccaccagaggaggatggaggctgctcaattaagtcttacatcctagagaag
agagaaactagccgccttcagtggaccaaactagctgaaaatattatagactgcagacat
gtagcccacaaactgatcaagggcaacgagtacatcttcagagtgtctgctgtgaaccag
tatggcactggagactctagccagtctggtccagtcagaatggttgacagttttggtcca
ccaggtccaccttcaaccccagagattgataatgtcagtaggaatgctgtcaccatttca
tggaagagaccagtaaaggatgggggaagtgatataaggggttacagtgtggagagaaaa
gaaaggagaggaatgagatgggtgagagcctctaagaggacagttcctgacctacgcttt
aaggtgcaaggcttgactgagggagtagagtatgaatttagagtcacggctgagaataag
gctggctttggggagccaagtgagccatcacatcctgtgatgaccaaggatattgtctat
ccacctggtcctccatccaatcccagaattgcagacaccactaaaaccacagcaaccttt
gcttggggccgcccccactatgatggtggtcttgaagtagaaggatacatcattgagtat
aaaaaggagggtcatgatgactgggagacagagacacagtacccagtgaaagttactgaa
tatgttattggtaaactccaaaaaggaggtaaataccatttcagagttagtgccataaac
tctgagggagtgggtgagcctgcagaggttgagaaagttactgaactgatggaccaagaa
acaatgccggactttgagctggatgctgaactcaggaaaaccttggtggtcaggtgccgt
gcttcaattcgtatctttgttcccattaggggccgccctattcctgaagtcacttggagc
aaagaaaataccaacttaaaagcacgtgcgcatatagacacaacagagtcctacactctg
ctggttattcctgactgtacgagatatgatgctggaaagtatcagctctgtctagagaat
gtcgctggtaagaagactggttttgttaatgtgaaagttctagacacaccaggaccacca
gtcaacctcaaaccaagagagatcactaagaacagcataacccttcagtgggaaattccc
ataattgatggaggttccaagattcataattacattattgaaaaaagaaatgccaccaag
aaggcctatacagtgctcagcaccacatggcaaaagtgttcttttaaattccaagatctt
caggagggagcttactactatttccgtgtgtctgctgaaaatgatctgggtgtaggtgag
cctgctgaaacccctgagccaataagagtgtctcaggccccctctgcaccagagaacttg
tatgtcactgatgtgacctctgacagtgctagccttgcatggaccaaacccctccacgat
ggtggtagtttgatcactggatatgtcattgaagctcagaagaaggacacagatcagtgg
gtccacataaccactatcaaggctctagattacactgttacagatctggttgagggtgct
gaatacaccttccgtataatggctgtgaatgcatcaggcaggagtgatccccgtgaaagc
agacctgcaataatcaaagaacacacctcagctccatcgtttgatctgagaggggtctac
cagaagaccgtgattgccaaggcaggggatcgtgtgaaagtagagattccagtgctagga
aaacccaggcctgtggtttcatggaagaagggagactttgcattcaaggagacacaaaga
atgaacattgaaaccacatcaacttcaactatcctcaacatcagtgagatcaaaaggact
gatggaggccagtattccatgacagcaaagaacatgcttggtacaatgacagagaccatc
actgtcctggtccatgatataccaggtcctcctagtggtcctatcaaactggatgaggtc
tcatgtgattatgtaattctctcctgggaacctccagagaacgatggaggtgttcctatt
aataattatattgttgagatgcgggagactactggcacttcatgggtggagttggcagca
actgttatccgcaccacattcaaggcagcaaaactcaatactggtactctgtatcagttc
cgtgttaaggctcagaacagatatggcattggaccttgcattcagtctgaaccagtgttg
gctgcctatccatttgatgtgccaagccagcctggcagtcctgtggtaacatctttcaac
aaggattctatgactcttagttggaatgagccttctgatggaggtagtcctattctaggc
tatcatgtggacagaaaagagaagaatagcattctgtggcagaggatcagcaaagctctt
gttgttggaaacatcttcaaatcgacaggccttgttgatggcattgtatatgaacatcgt
gttactgctgaaaacatggctggtctcagcaaacctagcaaaccatctgagcctatgtat
gctttggacccagtcgaaccaccaggcagacctgtggcactgaatattaccagacatgag
gtgacactgtcttggaccaaaccagaaggcgatgggggattctccattactggatacaca
gtagaaaggagagagacacctaacggacgctggctcaaagcaaacttcaacaacattcta
gaaaccatgtatacagtcagtggtctgactgaagatacaacctacgaattccgtgtgttt
gctcgaaactcagctggtgctgttagtgctccatctcagccatcagaggcattcacatgc
agagatgacattgaagagcccaggctcgatgtggatgtagtatatagcagcactgttgta
gttatggcaggagagccattcaagctagaagccagtgtgactggcaggccaataccttct
ttggtatggaccaaagaaggaaaggagctggaagatacaggcaaaatagaaataaagaca
tcttcctttcacacaacactaatcaataaagattcactcaggagggatggtggtgctttc
atcctgactgccagcaatcctggtggctttgccaagttcacattcaatgttaaagtactc
gacagacctggaccaccagattccttaactgttacagatgtcacttcagagaaatgtgtg
cttaactggctgcatccaacacatgatggtggtgccaagattgagtacttcatcatacag
aggcgtgagaccagtaggttggcatggacaaatgtagcgacagaccttcaagcaaacaga
tttaaagttacaaaacttcttaagggcaatgagtacgttttcagggtcatggctgttaac
aagtatggtgtgggtgaacctttggagtctgaaccaataatttgtgccaacccctatggt
cctagtgacccaccaacacaacctgaggtcaccacaattaccaaagactctatggttgtc
tgctgggagcgtcctgaacatgatggaggcagcagaatcaacacatacataatagagaga
agggataagactggcctacgctgggtgaagtgtaacaagagaactgtaactgacttgcga
ttcaaagtgtctggcctcacactaggacatgaatatgaattcagagttcttgctgaaaat
aatgctggtctaagccagcctagtccttccagtccattctacaaagcaatagacaccatc
ttccagcctggacctccagggaacccaagagtgcttgacaccacaaaatcttctattaca
gttgcctggaacaaacctgtttatgatggtggttctgaaatcactggttacattgtggag
acctgcctgcctgaggaggatgagtggacaatccatactcctaaaaagggatggacagcc
acttccttcaccatcactaatctgaagcaaaaccaggagtataaaatcaatatctgtgcc
actaattgtgaaggagtgggagagcctgcttctgttcctggaacccctaaggctgaagac
agactacttcctccagaaattgaacttggagcagaactacgtaaagtagtatgcatcaga
gcctgcagtacgctcagactatttgtccccatcaagggcagaccagcacctgaagtaaaa
tggtcaagagagcatggagaatctctagacaaagccaacattgaaatcacttcatcattc
acaactcttcagatagatgttgttgacaaatttgatgcagggaaatacttggtgacagta
gaaaatgcatcaggaagtaagacagcctttgttaatgttagagtactagatactcctgga
gcaccccagaatctgactgttaaagaggtcactagaaactctgtttccctggtttgggat
gcacctctgatagatgggggctccagaatccgcaactacattgtggagaaacgtgagtca
accaggaaagcttactcaactgtttgtgcaagttgccataagtctagttggaaagttgga
gacctggaggaaggaaaattgtacttctttagaatccttgctgaaaatgagtttggtatc
ggtcttccagtagagactcttgaatcaattaaagcatcagagaagcctctaccaccaggc
aaagtgtcccttcgtgaagtgactagcaaaagcgtcacactaacttgggaaaaacctgac
catgacggtggaagcagaattacaggctatattgttgagatgcagagtaagggaagtgag
aaatggactcaggtcatggtggtaaaaaccaatgaggctcaggttactggacttacacaa
ggggaggagtatatgttccgcatttcagccaccaatgaaaagggtgttagtgacccacgc
cctctcagtctgcctgtgatagctaaagatttgattatcccaccaacttttaaactgctt
ttcagcacattcagtgcactggcaggtgatgatcttaagattgatgttccatatgttgcc
tgccccaaggctacagcaacttggctcaaagatggtgttgtactcaaggaaacaataaga
gttaatgctgaggccacagacaaaaacctccatcttgtcattaaggaagcttgcagagat
gatgtagggacatatactataaaactaaccaacacagctggagaggctacagcagatatc
agtgttgttgtcttagataaacctggtcctccagctggcccaattaagctggatgaagtc
actgctgacagtgtggttttgtcttggaatccaccactgtatgatggtggttgtgcaatc
aataattacattgtagagaagagagacacatcgactactaactggcagattgtgtctgct
acagtagccagaacaactatcaaggcagtccgtctgaagactggatttgagtaccaattt
agaattgctgcagaaaatagatatggcaagtcttcattcctgctgtctgataacattgtt
gctcagtatcctttcgaagtgcccagttcaccacgttctgtgttggtgcagtcagtcacc
aaagagagcatggttgttgtatgggagaaacctagcaatgacggtggaagcaaaattctg
ggctaccatttggaacttaaagagagaaacagtattctgtgggtgaaacagaacaaacag
ctcattcaagaaaccagatttaaggttgttggtctcgaggagggtattgaatatgagttt
agagtctatgctgagaatattgttggcctcagcaaagccagcaaagtgagtgaaatgcaa
gtggccagagatccttgtgacagaccaggaaaaccagaagctgtcattgtaacaagaaac
aaagtgacactgagatggaccaagcctgagtatgatgctggtatcaagatcacaggttat
gtggttgagaaaaaggagggaggtggccgttggatgaaggctagttttgccaatgttatt
gagactgaatttgttgttacaggacttactgaggatcagacttacgagtttcgtgttatt
gccaaaaatgcagcaggtgtcttcagccaaccatctgattctactggaaccatcactgcc
aaggatgaggttgatccacctagaattgacttggagactaagtactcccaagctgtggtt
gtaaatgctggagagacatttagacttgaggcaggaatttatggtaagcccgtgcccact
gttcactggctgaaggaaggcaacgagattacagaagcagctcgtttagaaattcacaat
acagattttatagcttgtataattgttaaggaagccattcgtgttgatggaggtcagtac
accttgctggtgaagaatgttggaggagagaaaacagttaacattaatgtcaaagtcttg
gacagaccaggtccacctgagggccctatatctatctatggggtcaccagtgagaaatgc
tcaatttcctggaaacctcctttgcaagatggaggtagtgatgtttctcattacattgtt
gaaaggagggaaaccagcagacttgtatggactgtaattgaacaaaaagtacagactctg
aatctgaaaatcaccaaacttcttcctggtaatgagtacatattcagagtaatccctgtc
aacaaatatggtattggtgagcctttagaatctgagccaatgattgccaaaaatccattt
gtcgctccaagcccaccaacagaagtagaagtctccacaattaccaaggactctatggtg
gtgacttgggagagacccgttaatgatggtggtagtccaatccaaggttatgttgttgag
aaacgtgacaaggatggtgtgagatggactagatgcaacaagcgcactttgactgagcta
cgctttagagttacaggtctcattgaaaaccatagctatgaatttagagttgctgctgag
aatgctgcaggacttggcacaccgagcacaccaacagtgtactacaaagcactggatccc
attttcgaaccaggcccaccaaacaaccccagagtggtagacacctctaggtccactgtc
tctcttacatggggcaaacccatttatgatggcggctgtgagattcaggcttaccttgtt
gaggcatgtgatgtagcatctgaagagtggtttatgtgcactcctcccactggaataaca
gacactaaattcacagtgaaaaagcttctggagaaacatgagtatcagttcagagtttgt
gcaatcaacaaagttggtattggtgaacatgctgatgtgcctggaaaaattcttttagag
gaacagcttgagcctcctgaccttgacttagatgctgatatgagaaaaactgtcaacatc
agagcagcaagcactctaagactatttgtaccagtaagaggtcgtccagctcctgaagtg
aaatggggcaaggctgatggagagattaaagaaactgccttaattgataatacaggaagc
tatgctttacttgttatcgagaatgttgacagatttgacagtggcaagtacaccttaact
gcagaaaatgctagtggagtgaagtcagccttcatcagtgtcagagtcctggattcccct
agtccgcccactaacttaacggttaaagagattacaaggaactctgtcactctctcatgg
gagcctccacttttggatggtggctcaaagattaagcattacattgttgagaagcgtgag
agcaccagaaaagtatactctcccattactacctgcaacaagatgtcatggaaagttgag
tctcttccagagggtggaattttcttcttcagagtcttggctgagaatgaatatggtgtg
ggtcttcaagctaaaactattgagccaattaaaatatctgagaaacctcaaccacctggt
aaggtcagtgttgttgatgtcactcacagcactgttactctaacctgggaaaaatctcaa
tatgatggtggcagtagaatcagtcactatgaagttgaaattgctcctaaggacagtgag
acttggtctccatgtgccagtgtgaaaggcacagagacagaagtaagcaaccttctaaag
ggagaggaatatcagttcagggttattgctgtaaatgaaaagggtaaaagtgacccaaga
caactggttcagtcggttgtagcaaaagaccttgtcattgaaccttctgttagacccaaa
gtgagttcgtacagtgttcaggtggggtatgatctcaagatagaggttccaattgctggt
catccaaaacccaccatcacttggaccaagaatggagtggcgcttaaacagaccaccaga
gtcaatgtcactgactcagcacatcagacaactctaaccattaaggatgctaccagagag
gatagtggtatgtacactatcaatattgccaattccctgggttctaaggatgccactatt
gaggtaatcaccctggataaaccaggcccaccaacaggccctgtcaagattgaggatatc
agtgctgagagtatgactcttagttgggaagctcccacatacacaggtgggtgtccaatc
tccaactatgtagtagagaagagagacacaactacaactaactgggttgttgtatctgcc
actgtggccagaaccacattaaaagtatccaatctgaagacaggtggtgaataccaattc
agaatttttgctgagaatagatatggaaagagttatgcaattgattcacagcctgttgtg
gcacagtatccattccaggaacccggccctccaggtacaccatttgtgtcctcatacact
aaagattatatggtggttgaatggcataaacccccatctgatggaggcagtgccattttg
ggctatcatttagagaggaaagagaagaacagtattctgtggaccaagataaacaaaatg
gtcatccaagactgcaaatttaagtccactccacttgaggaaagcattgagtatgagtat
agagtatatgctgagaacatagttggcattggaaaatgcagcaaagtatctgaggtttat
gtagcccgggacccatgtgatcctcctggccgtcccgaggctgtgattgtaaccaggcac
tcagtgaagctaaagtggtcacctccacaatatgatggtggaagccttgtaactggctat
atagtagagaagcgggaccttcctgagggaaaatggatgaaggctagcttcgcaaacatt
attgaacgagaatttacaattacaggccttacagaggacaataaatatgatttcagagtg
attgcaagaaatgcagcaggtgctgccagtaagccttccgagacaacaggatccataaca
gccaaggatgaagttgagccacctaagtgtgagactgatcctatgtacaatcagactctt
gttattaatgctggagacacatttagtctggaagccagtgtggaaggaaaacccatccca
acagctcagtggttcaagggaagtgttgaaattgaaaactctgcaagaagtgaaatcaaa
aatacagattttaaagctttgcttgttgtgaaagatgctatcagagtggatggtggacag
tacactttggttctcacaaacgttgctggaactaagactgtcccattcagtgtgaaagtt
cttgatagaccaggcccatcagagggaccccttacaattagcaatgttactgaggagaaa
tgctcactgtcatggttgccacctaagcacgatggaggagctaccatttctcattatata
attcaaaagagagaaaccagtcgcttggcatggactgtggtttccagtgattgtggagct
acaatgttcaaggttaccaaactactgaaaggcaatgagtacatcttcagagttttggct
gtcaacaaatatggagtgggtgagcctctcgaatcagaaccagtcatcatgagaaatcca
tttgttcctcctggctcacctcatgaacttgagatcactaacattaccagggattccatg
actgtctgctggaaccgccctaagaccacaggaggaagtgatattgttggttacattgtt
gaaaagagagaccgagctggagtgaggtggaccaagtgcaataaacggagagtgacagac
ttgcgttttagagtaacaggactcaccgaggaccatgattatgagttcagggtctctgct
gagaatgcagctggagtaggccagccaagcccacctacaccctacctcaaagcatgtgat
cccacctttgaaccaggctgtcccaccaatgctcatgtggttgacactacaaaagactcc
atcagtttagcttggcataggcctatatatgatggtggttgcgagattcaaggatatgct
gtggaaattaccaaggctgatgaggaggaatggactttatgcacaccacctactggagta
aacaaaaccaagttcaccatcaaacgtttgacagaacatcaagaatacaaagtgcgcatt
tgtgcagtcaataaagaaggagttggtgagcccacagaaatccagggagttgtgataccc
attgataagattgatcctccagaggtgattctggactcagagctcaggaagggaatagtt
gttcgtgcaggaggctcaatgagaatctgcattcctttcaacggtcgtcccgttcctgaa
gtaagctgggccaaggaggatggcgagctgcccactaaagttcaggttgagatgggtgaa
gattacacgcagctctccattggtatatgtgacaaatatgatgcaggaaaatacatcctc
aatttagaaaatagtgctggcagcaaatcagcttttgtctctgttaaagttctggacact
ccaggagctcctttaaatctaacagtaaaagacataaagagggagagtgtcactttgacc
tgggaacctcctgttattgatggtggttcaagaataaagaattatctggttgaaaaacgt
gagtccacaaggaatgtgtactctaatgtagataacaaatgcacaaagacaagctaccgt
atcactggtctaactgaggggacaatctactatttcagagtattggctgaaaatgaattt
ggtgttggacagccaattgagacagaacaatcagtcaaaacctctgaaccacctctgcct
gttggtaaggtaaatctgactgaagtcactaaaaccactgtttcactctcctgggagaag
ccagtccatgatggaggtagcaggatcattggctactacattgagatgcagcctgtggga
tcagaagaatgggttgttgctgccacaactaaaacttgtgaaggcactgtcacaggtctc
agtacaggacatgagtacctgcttagagtgtcagctttcaatgagaaaggcaagagtgac
cccagagctctggctgcaccagttactgctaaagatgtaactgttgagcccagatttaag
atcagattcactacttatagtttacagcaaggtgaagatctaaaaattgaaattccagta
atcggacgccctgttcccaaggttgaatggaaaaaggaggggcaagctctgaaggagacg
accagactaaacgtatctagcacaccatcatccactaagctggtcatcaaggatgcaaat
aaagaagattctggtaaatacactatcacagccaccagcagcattggaacaactacagag
gagattacggtcgtcattcttgacaagccaggaccacccacagggcctgtgaaaattgaa
gaggtgagctgtaactttgttactctttcctgggagccaccagagtacacaggaggctgt
cagatcaacaactacattgtagagaagagagacacaaccactacagcatggcagattgta
tctgctacaattgccaggacaaccattaaagtcaccaatttgaagactggtgttgaatat
cagttcagagtgtcagctgagaatagatatggaaagagttcagctattgtctctcctgct
gttgttgccaagtatccatttagtgagcctgctgccccaggatcaccagttataacagct
gcaaccaaggatagtatggttgttgaatggaaacctcccaccaacagtggaggcagccca
attattgggtatcacctggagagaaaggagaaaaacagccttttgtggacaaaactcaac
aaacttctaatccctgacacacgattcaaaactacagagttggaagaaggtattgaatat
gaatttagagtttatgctgagaacattgctggtattagcccagccagcaaggtctctgag
accacagtagctagggacccatgtgacccaccaggcactcctgaggccattgaaatcacc
agaaaccatgttacactccagtggaccagacctcagtatgatggaggcagtgcaatcact
ggctatgtgattgaaaggaggaagcacccagatactcgctggatgaaggccagcttcacc
aacattattgatacccagtttacaatcactggtcttactgaggactgtgtttatgaattt
agagtcattgccaaaaattcagctggcatttctagtcgcccatcagggagcacaggagag
attacagccaaagatgcaattgaggctccagatgcaaccatggattctaaattcaaggat
cttacagttgttcatgctggtgagtcatttgtcattgatgctgactacaccggtaaacct
ctgcctgaggtcatgtggttgaaagatggaaaggaaattgacaaaaccacaccaagaatg
gagataaagaccacacttacccgtactattttgacagttaaggattgtattagagtggat
ggtggtcactttgtcctcaaacttgtgaatgtgggtggaatcaaaatgatcccagttaat
gtcaaagttctggatagacctggtcctccagatggacccttagaagtcaaaggagttaca
gctgaaaaatgttatctgcactggaaccatccctcacacgatggtggtgctagcatctca
cactatatcattgagaagagggagacaagtcgtttgtcttggactgtggttgagcccaag
atccaggctatcagttacaaaattacaaaacttctccctggaaatgaatacatcttcaga
gtaattgctgtgaataaatatggtgttggtgaacctttagaatctgagcctgtgattgct
cgtaatccattcaccactcccagtgccccctccactcctgaggccagtgctattactaga
gattctatggtacttacctgggagaggcctgagaataatggtggagctgagattgaagga
tatgtacttgaaaagcgtgataaggatggtgtcagatggaccaagtgtaacaagaagagg
ctgactgatctgagattcagatgcgctggcctcacagaaggccactggtatgaattcagg
gtctcagctgaaaatgctgccggtgttggaaaacctagcacaccaacacagtacgtcaag
gcatgtgacgccatttatccaccaggacctccaagtaaccccaaagttacagatcattca
agcaccacagtctcgctttcctggtccaggcctatctatgatggtggggcacagattact
gggtatgttgttgaaaggaaggaagcaggagatgatgaatggtttgtctgcacacctcct
actggtgtccaagaaactcactacactgtaaagaaactgaaagagaatgtggagtacaac
ttccgcatctgcgctgttaattgtgaaggcgtaggcgaccatgtggacctacctgtgtct
gtgattgctgcagaaaaactggaggctcctgaaattgaactagatgctgacttgagaaag
atggtcaatgttcgtgccactgccacgctgcgtctttttgtgacgatcagaggaaagcca
gagcctgaggtcaaatggtcaaaggctgatggtacactgaatgaacgtgctcagattgaa
gtcactagctcttacacaatgctggtgattgagaatgttgacagatttgacaccggcaaa
tacacactgacccttgaaaaccttagtggctctaaatcagcctttatcaatgttagagtt
ctggactcccccagtgcacctactaatctgcaagttaaggacgtaaaaagacattctgtg
tctctttcctgggaaccacctcttattgatggtggggctaagatatcacactatattgtg
gagaagagagagcaaaaaagaatggcgttcactagtgttagcactaactgtgtcaggaac
tcctatattatttctgacctgcaagaggggggcagatactttttccgtgtgctagctgtg
aatgaccttggagtaggtctgcctgctaccacagatcaagtcaaagtatcagaggctcct
ttgcctcctggtaaggtcgttgtggttgatgtgactcgtcatactgtcactctttcatgg
gagaaacctgatcatgatggaggcagcaaaatcacaagctatattgtggagatgcagcct
aaaggagatgacaaatggacagtgtgcagtgaagccaaagctctggaagctactattgat
ggactcattgctggcgaggaatactccttcagggtaattgctgtaaatgataagggaagg
agtgatgctaaacctttggccacccctgttgtagtaaaggacatcacaatggagcccata
attaacctgctgttcaatacgtacagtataaatgcaggagatgactttaagattgatgtt
cccttcaaaggccgacctcaacctgaggtgtcctggaagaaggatggtcagatgctgaag
cagacaaccagggtaaatgttgtgaattccaagacctcatccaagattgtcatcaaggat
gctaccaaagaagatgttggaaaatatgagattacactgactaattcagttggcaccaag
acagctgaaatctcagttatagtcctggacaaacctgggccaccaagcaacattaaaatg
gatgaggtgagtgctgactttatctccttgtcctgggatcctccgacctatgatggtgga
tgccaaattaacaactatgttgtggagaaacgagacactacctctaccacgtggcaaatt
gtctcagccacagttgcaagaacatcaataaaggtttctcgactcaaccagggcacagag
taccagttccgcattgcagctgagaaccgttatggcaagagtcctgctgttaactctgct
cctgttattgcccagtatccatttgagcctcctagctctccaaccaatcttcatgttgcc
catgccacaaagactagcatgttggtagtatggggtagacctgctagtgatggtggaagt
cctgttattggttatcatattgaatgcaaagaccaaagcagcatcctgtggagcaaagtc
aacagaggcctcttggctgaaaaccagttcaagatgactggcattgaggaaggcctgttg
tatcagtttagagtctatgctgaaaatattgctggcattggtccatgcactaaaccaagt
gatcctgttgcagccagggatccttgtgaatctccacataaccttagagtcacaaacatc
actagaaactctgtttccctcttctggaatgcgcctgaatatgatggtggcgtgaaaatt
actggatatattgtagagcgtaaagaacttcccaatggtcgctggctgaaatgcaacttc
accaacgtgcagggcacctactttgatgttactggcctcacagaagatgcccagtatgac
ttccatgttattgcaaagaattcagcagaaatgctgagtgctccttcagaaaacactggt
cctgtcactgttaaggatgatgtagatcctccaaccattatcatggaggataaattcaga
cagctggttgtcattaaggctggagagatcattagaatagatgctgaaatcacaggacgt
ccacttcctgtgctttcctggtctaaggatggcaaggagattgaggccaaggccaggtgt
gaaatcacttccaccaattttacaaccaccctgattctcagagatgctattagaaaggac
tctggtcagtatgtcctgactctgcacaatgttgccggaacaaggtctgtggctgtcaac
tgtaaggttctggacaggcctggaccttcctcaggacctctggcagtgtctggcgtgaca
gcagagaaatgcattctaacatggggacctcctcaagagaatggtggtgctgaaatcatg
cattacattgtggagaaacgtgagacaagtcgccttgcctggaccctggtctatggggat
atgaaggcaactacttgcaaagttactaagctgctcaaaggaaatgaatacatcttcaga
gtcaggggagtaaacaaatatggagatggtgaagctctagaaagtgagccaacaaaggca
atagatccattcactgtgcctgcagcccccactaatgtcgaggtcactgcagttactagt
gaggcaatgacaatttgttgggaaagaccagtttctgatggtggcagcagtatctctggc
tatgtaattgagaagcgggagaagactggcctccgttggtgccgtgtcaataagaaacct
gtttatgacctcagagtcaaagcctctaacctccgtgatggctgtgagtatgaatacaga
gtgtttgcagagaattctgctggcctcagtgctcctagcataccttgcccactcattaag
gctgaagacccacagttcctgccctcacctcctcctaaacctaaaatcattgactcttca
aagaccacagttacactgacttggagtaagccactatttgatggtggagcacctgtgact
ggttacagagtagaatacaggcagacattagatgatgaatggattattggagtccataac
accaaaaacacagagtttactgtggtgggactgactcccggagttgaatatgtgtttgtt
gttaagtccattaacaaaattggaatcagtgaccctagtgccgagtcagataaacagatt
gctaaagaaagagaagaagaaccagccttcgagatcagcaatgagatgagaaagactctt
attgtgaaagatggaagctcatttactatgacagtacccttcagaggaaaacccattcct
gctgtttcatggactaaacctgacatcgaccttagagtacgtgctgtcattgacaccaca
gacacgttcacctcaatcaccttagaaaaagcaactcgcaacgactctggaaaatacaca
gtcaccttgtccagtgttgttggaacttcctcacttacactgaatgttagagtccttgac
tcacctggacctcctgctaatgtggaggtcaaggaagtgaccaagacctctgccactgta
acctgggacatgcctgagaatgagggaggaggaccagtcaagaattaccttgttgatttc
cgtgaggccagcaaaaaaggttggactaggttgactgatagatgccatagactgacatac
aaagtgacaaacctgaaagagggagaagtttactatttcagagtgacaggcgagaatgac
tatggtgttggtattcctgctgagaccaaagatggaaccaagatcacagaaaaaccaagc
cctccaccaaagctaggagtaactgatgtcagcaaagatagtgtgtcattggcctgggct
aaaccagaacaagatggaggaagcagaattactggctacctagttgaagctttggagaaa
gatcaggagaagtgggtaaagtgtggtgtcaccaagttcacccacttcacagtgtctggc
ctgagggaaaaagcagagtatttcttcagagtcagagctgagaaccacgctggactcagt
gactttaaggagatggttactcctgttatggtcaaagaccagcttgaacctcctgaggta
aacatgaaggacttcccctacaacacagtgtatgtcagagctggctccaccctcaagtgt
gagattccgctgacaggccggcccatgcctaaagtctctctttccaaggataatgtgctg
ctcaagtcaacaatgaggttcaactctgaagttactcctgacagcatcaaaatcactctg
cgtgagagtgttgctggagactcaggacgctatgacatcactgcctccaactccagtgga
accaccaaatcctatatcaaaattgtggttctagatagaccaagtgctccacttggacct
gtagaactgtttgatgtcacagaggacagtgtaagtctgacatggcttccaccagcatat
gatggcggcagccccatcactaactacattgttcaaaagagagaaacaactacagccaac
tggatggatgtctcctctgctgtggcccgctgcaccatgaagatcatgaagctgaccact
gggctggagtaccagttcagaatcagggctgaaaacaaatatggaatcagtgaacacatt
gactcaccagctgttaccgtcaaccttccatacacgactccagatgctccatcaactcca
gaaatcactgctgtaaccagggagaccatcacattagcctggaaggagcctaaatcagat
ggaggaagtcacgtgtttggctaccatctccagatgaaagacaagaacagcatcctgtgg
cagagagttaacagaactgtaatccgtgctacgcacttcaaggtcaccaccatcaacgct
ggactcatttatgagttcaaggtggctgcagagaatgctgctggactgagtgctttcagc
aaagtttcagatgctgtgctggccatagatgcttgtgagccacctatcaacctgcgcatc
agtgacatcaccaaaaactccattagcctggcctgggagaaacccaactatgatggtgga
tcccccatcactggttacatcatcgagaagaaagaagttgttggtgccaagtggtccaaa
gccaacctgaccaatgtctctgacacacgcttcattgtgactggccttacccagaacgag
acatatgagttcagagttatggccaagaatgcagttggctcagtcagcaacccgtccatg
acagctggaccagccacctgtgtggacacctacggtgcaccagaggttgaaattcctcag
gagtaccttaatgaggtcaaataccatgctggctctgatgtggaactcaaatttaatatc
tcagccaaacctgccccaaccattgagtggtttaaagatggcagagaactgaagcccact
gctcagctctcttttaaacacacatttgagttcaccagtatatttatgaaggagactact
cgcctgaactctgggacgtatgaggtcaaagtgaagaactctctgggatctgcgtgtggc
attgtcaggctgctcattcaagacaagccaggacctcctgctggagaaatccagttcaag
aaggtgacagctgacaacatcaccatcatgtggtctccacctgccgatgaggggggtgct
atggtaactcattacatcgtagagaagagggagaccagcagagtcatgtggtccattgtg
tcagagaaactcgcggactgcatcataaacgtacccagacttatccagggtaacgaatac
atcttcagagtccgtggagtcaacaagtatggcatcggagacccactagagtcggatccc
attattgccaagaacccatttgttcctcccagtgagccatccaggcctaaagttaccatg
atcacaaagtccacaatgacagtgatttgggaaagaccagcactagatggaggcagcgat
attgatggttattaccttgagaaaagggagaagaagagtctgcaatggtttaaggtggtg
aagggctccatcagagacactaggcagaaagtcagcaacttgacagagaacaatgagtac
caattcagggtttgtgctgtcaacaaggctggtgcaggaaactactctgaggcctctgac
ctttacaaggcctatgaccccattgatctgcctggtgaaccctccaaactgcgtgtggtg
gactccacaaggacctccatcactctgggctgggagaagccggtatatgatggtggcagt
gaaatcacacactacatactggaacagatgaatgcagaggacaaagaatgggtgatcatc
aacccacaggtcaagatgtgcgagtatgtggtgtctcacctcaaacctggcacttattac
tacttcagggtctctgctgtgaattgtaagggtaaaggagaggacatcaagatgtaccag
cctgtacaagccaaagacattttagaggaggctgacttggacttggatgtatctatgaca
actcagtacacagctcgggctggccgtgatatcgaagtgtttatccctctaaagggacgc
ccagctccaaatgtcacctggcgccgtggcgatcgcaacatggctagtgacaaccgctac
accatcagcagcactgagagatccactacactcctcatcccaaaagtcacccgcgatgac
tgtggaaagtatgtgctggagatagagaatggtgtaggagaacccaaggtaatcacagtt
tccctaaaagttctcgacagtccatcctcttgccagaaacttatagttaagaatgtgaca
agaggacagttgaccctcagctgggaagctcctctcattgaaggtggatctcctgtcact
aattacattgtggagaagaaggcttccaccatgaaagctttccaggtaatcactgtagag
tgcctgaacacctcttacaaggtgtcaggcttggaggaggatgtagcttacttcttccag
gtgtcagctgaaaatgagtttggtgtgggtgacccctgtgagaccactgagcctgttaga
gcaacagaaactccaggaggcgtcaaagacctggcaatgggggactctacaaagaactct
gttaccctgcagtggacccgacccgaccatgatggaggcagccacatcactgagtacata
attgaaaagagaagcctggaagaagtcaattggagtttaggtgccacatgcaagcgctgc
acttgtgaggtgacaggactcaaggagaatactatcctggatttcagagtatttgccaag
aatgagaaaggcagaagtgacttctcccagattggtccaatcacagtgatggacttcatt
attccccctgaagcaatcctcaatgattaccccaacggagagcttgctgttcgtattggt
cagaacatccacatcgagctgccattcaagggtaaaccaagacctgcaatcagctggctg
aaggataactttcctctcaaagaaagtgaaaagattcgcttcaggaccactgacaacaag
actgcagtcacagtcagaggagccaaaaaagagaatgctggccagtacaccttagtttta
gacaacagaattgtcaagaactactttgatatcaatgtgattaccctgggacctccatca
gtgcctgttggtcctattcgctttgatgagataaaagctcagagtatcatcatctcctgg
gatgaaccaaaggagaatggaggcggtgagattacctgctacagtgtggagaaacgtgaa
acctcccaggccaactggaaaatgatctgttccagtgttgtcaggaccagcttcaagatc
cccaacctggtcaagggaacccagtaccagttcagagtccgtgcagaaaacaagtatgga
gttagtgagccactcaactcatcagacataattgcccagcaccagtataaagctccaggc
ccaccaggaaagccagtatcctacaacatcaccagcgatggtataaccattaagtgggaa
gccccagactttgatggaggttcccccattttgggttatcatgttgagaagaaggacagg
aatagcctgttgtggcagaaggtgaactccactctcatttccaacaaagagtacaggatc
attggtctcttggagggtttggagtactcctttagagtctatgctgagaacaacgctgga
atcagccctgtcagtgaacagagcaaacatgctcgtgccatttcccctgttgatccacct
ggcacacctgtctgcattgatgtaaccagagactcagtttccctacaatgggacattccc
aagagagacggtggcagcaaagttgtggcatacagtgtggaaaggcgtcaaggcagaggc
aaatggctacgatgcaattttactgatatcagtgagacccagttcactgtgaccggtcta
tcccctggagacagatttgagttcagagtgattgccaggaatgctgttggcaccatcagt
ccaccatctaactcctctggatacatcatgaccaaggatgaaagcattgctcctgaaatt
gagtggtctccagaccaggtgctcaccctgaaggctggagagaatgttcggctcagttgc
accatcactggacgcccactccctcagattgtgtggtacaaggatggcaaagagattgat
aagaggacaatgattgacatcgagatcaccactggcattggcaccagcagtttgtttatc
cgtgatgctgacaggaaccaccgtggaatgtacacggtggaagccaagaacagctccggc
accaggaaagcagacgttaacgtcagagtgcaagatactcctggacctgttgaaggtcca
atccgtttcaccggcatcacggctgacaaatgcactgtatggtggaacccaccagaaaat
gatggctgtgctgccatcacccactatgtggtcgagaagagggagacatccaggatctcc
tgggccctggtcacatccaagtgcgaagcttgttcatacaatgccaccaacctcatcaag
ggcaatgagtaccagttcagaatctctgctgtcaacaagtttggtgtgggcaaaccacta
gactctgattcagtcattgcacgaatgcagtacactgtgcctgatgcacctggtactccc
gatgccactcatgtgacaggtgacagtatcaccttgtgctggaccaggccgcgatcggat
ggaggcaatgagatcaaacattacgttctagaaaggagagagaagaagagccttcgctgg
gtgagggtctcctccaagagacccataacagagttgaggcaccgtgtgaccaacctcact
gagggcaacgagtacgagttccgcgtcatggctgaaaatggcgctggtgtcggaccagcc
agcagcacctccagactcttcaaatgcagagagccaaccagtgctcccagtgcccccact
gtgatcaaggtcattgactccacaaagtcttctgtcaccttgaaatggacaaagcctgtg
tttgacggtggcatggaaattattggctacaacatcgatatgtgcaaggccagtttggag
gagtggcacagagtcaacagtcaaatttgtatccacaacacgtacactgcaaagggtctg
gtacctggagagctctataagttcagggtcagtgctgtaaatggatctggacagggtgaa
gcttcagttatgccacacccagttcaggctctggacagacttacatctccagagattgac
attgatgccaacttcaagcaaactcacactgtgaagaatggaggcaccgtctctcttcat
attgctttctggggaaaacctgctccccttgccacctggtctaaagtagatggtgagctc
cctgttatggcagatgtgaacaccacagataccttttccactctaactatagaaggttgc
accaggtatgaggcaggtaaatacaccctgtccctggagaacaacagtggacataagtcc
atcacattcactgttaaagttctggacactcctggacctccaggagcaatctccttcaaa
gatgttacttgtggggccttgacattgatgtgggatgctccatctaatgatggtggagct
cgaatccaccactatattgttgacaagcgtgaggcaagccgccttgcctggcaggaggtc
agcagcaagagctcccgtcagacggtaagagtcacaggactggatattggtgtgccatac
ttgttcagagtgactgctgttaaccagtatggccagggagaacctcatgaaacgacagag
cccatcactgccacagaagaacctgcaccacccaaaagattagatgttgtagacactact
agctccacagcctccctggtgtggctgaaacccgaccatgatggaggcagccggatcaga
ggctacattgttgaattcagagcaacaggtactgaccgctggatcatgtatggagaggca
aagctgcagaagatgctggttgaaggtctgagtgagaacacagagtatgacttcagggtc
aaggccaagaatgatgctggaatcagtgagcctcagggtactttcagctcagtggtcatt
aaggagcctcgtattgaaccaactgctgacctcagcagcatcaccaaccagctcattacc
tgtaagatctccaacaccttcacaattgacatccccataagtggtaggcctgcacccaag
gttacatggaaactggaggagatgaagctgaaggagactgacagggtcttgatcagaacc
tcaaaggagagaaccacactgattgtgagagacagcaagagaaacgacagtggcaagtat
tatctgatcctggagaacgctgctgctgtgaagactttcacggtgacggtggtcattgtc
ggcagacctagcccacccacaggccccttggaggtttctggaatctcatcagaaacctgc
actctgtcctggtctgagccagcagatgatggtggaactgaaatcaccaactacatcgtt
gaaaagcgcgagtctggctccgcttcctggcaggtggttaactccagtgtgcaacgaacc
acaatcaaagtgactcacctcaccaaatacatggagtacaccttcagagtgtgtgctgag
aacaagtttggagtcagcaagtccatcgagtcctctgctgttgtgattgagcatccattt
attcctccaagtcctccaactcgtccagatgtggtctctgtgtcagccaatgccatcagc
atcaagtgggatgtcccgtatgctgatggtggtagcaaagtgacaggctactggattgag
aagaaggagaggaacacaatcttgtgggtgagggaaaacaagctgccctgcctggagtgc
cattacaaggtgtccaacttgatcgaaggcctggagtatcagttcagggtgtatgccatg
aacatcgctggactcagcaaggccagtgaagcctctagaccggtagtggcactcaatcct
gttgatcctcctggtaaacctgagattacggatatcagccgctcatccatttcattatgc
tggaccgtgcccttcaatgatggcggcagtaggattgttggttacattgtggagaaaaaa
gtctacagcacagatgagtgggatgacaaccgctggctgaagtgcaactacactacaatc
acagagaactacttcacagtcacaaacctgggagagggagagacctacgagtaccgggtc
attgccaagaacgctgctggggtccacagtgtgccctctgagtccactggaccagtcaca
tgcaaggacgaatactctcctccaagagctgagctggacagcaagctggtaggtgagacc
gtcaccgtcatggctggctccgacttggtcctggacggcgctgtgggtggaaaaccagaa
ccaacggtctactggtcaaagggcgacaagatcttagatcttggtgagaaatactcgctg
acgtacacctccaccagagccatggctgtcatcaagaactgtgacagatacgatacagga
agatacatcctcacagtgaagaacgccagcggaataaagactgcaaatgtcaacgtgaaa
gttctggacactcccggaccgccggctgataagatcgtgatcagcagagtaacggaggag
aagtgcacagttgcctggaagattccctacgaggacggcggagacatcgtcagccattac
atcgtggagcgccgtgagaccagccgcctcaactgggtgatcatggagacggagtgcaag
tctctgtcgtgtgtcagcagcaggctgatcaaaaacaacgagtacatcttcagagtcaga
ggagtcaacaaattcggacctggagttcctttggagtctgagccgatcatcgccaggaac
gcctacactgttccatcccagccgggcactcccgaggccacggctgtagcaaaggagcac
atcatcattgaatggctgaagcctgaaagcgacggaggaaatgagatcaaaacctacatc
gtggaaaaacgggagaagagcagcaccagatggactcgggtgaacaagacttacaccatc
tatgacacccgtctgaagatcactggcttgctggaaggaagcgagtaccagtttagagtg
acagctgtcaatgctgcaggagacagccagccgagtgacgccacaccttacattctctgt
agagaccccacatataccccagctgctccatcagtgcctcgcatctctgacaccaccaag
cacagcatcagcatgacctggacccgacccatgtacgacggtggctctgacgtgtccggc
tacgtggtcgagatcctcgaggagggctctgaacagtggtaccgtgctaccactaagcca
ctgaagaccaacgaatacgtagccgccggcctggcagccaataagaagtacaggttcaga
gtggctgccatcaacagcagcggcaccggagagttcagtgaagccagcgcagagatcgag
ccactggagagagttgaaatgccagacctggagctggctgacgacctgaagaaaaccaag
tgtctgcgggccgggggtactctgcgtctgctcgtgttcgtctctggtcgaccaacacca
gtggtcgcctggagaaagactggcgtggagctgcagagtcgtggctacatcgagaccact
gacagttacaccgcactcactatggagaaggttaatcgctatgactctggcaaatatgtt
gtggaggcagagaatccaactggcaagaagactgccaccatcttggttaaagtctatgac
actcctggtcctccaagttcagtccgggtgaaggactacactaaggaatctgttgtgatc
acctgggatgttcccaccattgacgggggcgcacatgtcagcaactacattgtagagaag
cgtgaagccaacatgaagtcatacaagaccgtaaccactgagtgcagaaaaaccttgttc
aggatcacaggcttagaggaaggtgcgcactacttcttcagagtcctgcccgagaacatc
tatggtgtcggtgagccctgtgagacaacagaacctgtcctggtgtgtgaagtaccatca
gtgcccatggacctttatgttgttgacgtcaccaagtcctctgtgacactgcactgggac
aaaccattgcacgatggtggcagcaggctgacaggttacatcattgaagcctgcaaggtt
ggttctgacaggtggagtgctgtggccacggtcaaagcctcatcgtcccagcacactatc
cagtccctgacagagaacgaccagtacctgttcaggatccgtgccaccaacagcagggga
accagtgagcccatggacatcgtaacaccggtcacaattcaggatatcaaggtgatgcct
aagattgatatgaccagcatccctcagaagatgatccatgtgcaccggggcaaacctatc
gatcttaacatccccataaaggccaaaccacagccggtctgctcctggtactttggtggt
gctaagctgaaggacagccttgaccgcatcaagatcgacagcaacagcaaatacaccaac
cttgttattcgtgacaccaccatcaatgacactggggactacacactagaggtgaaaaac
accattggcatggcaactgaagtcatcaaggtcatcatccttgataaacctggtatccca
gtgggtccagtgaagattgaggaggttgatggtgtatcagtgactgttagctgggaacct
ccagagaaggatggtggtgctaatgtcagcggctacgttgtagagcaacgtaatgcccat
catccaggctggaccaccgtctcagaatcggtgaccagaccttgcttcaagttcaccagg
ctcaccgagggaacggagtacgtgttccgtgtcgctgccatgaatcgcttcggtgttggt
ggcttcctgcagtctgaggtggtggaatgcaagagccccaagaccatccctggacctcca
agccagccagaggtgattgatgtcacccatgagggcatgaccgtaacctggcatccaccc
gaggacaatggtggctccaccattgctggctacatcatagaacgtaaagaggcccgttct
gacaggtggctgagaatcaataagaaccctgtcaccatgacccggtaccgttcatctgga
ctgattgaaggcctggaatatgagttccgtatcactgccatcaactccagaggaactgga
aaacccagtgaaagttctgccatcactgttgccatggaccccattgaacctccaggttct
ccagttcagcccagagtcacagacaccacaaggacttccgtctccttggcctggctgcca
ccagaagaagagggtggatctgttgtttctggctacttgattgagatgcagaaggtggac
caagtcgaatggacgctgtgcaacaccacacccaccaagatgtgcgagtacacccttacc
catatgccccagggtgcagaatacaagttcagggtcatggcctgcaacgctggtggtgct
ggagaacccgcagagattcctggagtggtgaaagtccaggagatgcttggttatcctgac
tatgagcttgatcgtaaatacgaggaaggctacgtggtgcggcagggtggcgtcatccat
ctgtctgtacccattaagggtaaacctgtcccaatagctaagtggaccaaagatggtcgc
gacatctcccatcgcgccatgattgctacctatgatgacatcactgagctggtaatcaaa
gaggcacacagagatgacaccggcacctacgacctggtgctggaaaacaaatgtggaagg
aaggccgtctacatcaaggtcaaagtgattggtcgtcctgatgccccagaaggacccctg
gaatttgacgacattcaggccagatcagtccgtgtcagctggagatcaccttcagatgat
ggtggatctgacatcttgggttacattgtggaaaggcgggaagtaccgaaggctgcctgg
tacacagtggacgcccgggtaacagagacctctctggtggtgaagggtctgaaggagaat
gtagaataccacttcagggttttcgctgagaaccagtttggtgttagcagatctctcaag
tcagaagaatctgttttgccaaagacacctctttgtccacctgagcctcccagcaaccca
ccagagatcatggatgtcaccaaaaccacagtgtctctgtcctggtcccggcctcgggac
gatggtggctctcgtgtaacaggatactatgttgaacgaagagaagtttcaacagagaag
tgggttcgtcacaacaagacccacatcaccaccaccatgttcaacgtgactggtcttata
cccagtgcagagtacatgttcagagtggtggctcaaaatgacattgggcagagtgaagct
ggtcctgcttcagaacctgtggtctgcaaagatccatttgacaaacccagccaaccagga
gatatcgatattgtctccatcaccaaagacagcatcaccatccactggctcaggcctgaa
catgatggtggaaaagagatcttgggttactgggttgagtacagggaggctggagagagc
gcctggaagaaatgcaacaaggagcgctccaaggatcgtcagttcaccatgggcggcttg
atggaggctactgagtatgagttcagaatctttgctgagaatgagactggactcagccga
cctcgtcgcacacctatgggcatcaagactaaactgagtgttggtgaagctccagctctg
aaggaagagattgaagatgtaaccaccaagcttggcacatctggcactcttacctgtgga
attataggcagacctctgcctgagatcaagtggtatcgctatggcaaggagctgatccag
agtcgcaagtacaagatgagctcagatggccggaaccactccctcaccatcctgacggag
gagcaggaagatgagggcctgtacacctgcagggccatcaatgaggctggtgaggtagag
accagtggcaaactgcgcttgcaggcaccacctcagttccaccctggtttccctttgaag
gagaagtactttgctggggctggtaccagccttcgtctccatgtcgtctacattggtcgt
cccatccctcagatcatgtggttctatggcaagaaacctctgaatgcatcggagaatgtg
ataatggaaaacacagaaagctacacccacctggtggtgagaaacgtccagagaaaaact
aacgctggtcgttacaaggtgcagcttagcaatgtttttggaaccatcgacactgtgctg
agagttgaaatccaagacaaaccttgtatccctgagggccctgtcattgtcgaagccctg
ctgaagaatgtagttgtgatcagctggaaggttcccaaggatgatggtgggtctgtgatc
accaactacattgtggagaaacgtgaggccaaagaaggtgaaaagtggcacctggtgtcc
tcttctgtctctggcaccacctgccgtgtccccaacctgacagaaaatgctggatactac
ttcagagtctctgctcagaaccagtatggagtcagtgagcctcttgagatcccatcagtc
gtcatcatcaagagtccatatgataaacctggaataccacagcagcccttcatcatcagc
tcctccaaggactcctgtgtcgtttgctggaaacctccaagcagcgacggtggagcgaaa
atcaccaattactacctggagaaacgtgagaagaagcagaacaagtggatgtctgtaaca
accaagaagattgtggagacaagctatgaagtccaaggcttaattgagggctttgagtac
gaattccgtgtgaaatgtcaaaacataggaggtgagagtgactggagtgagatctctgca
ccaatcatccccaagtctgaacaggcccctcgggctcctgtgttcagggaggagatcaga
gacatgactgtcaaatatcacgccaatgccacctttgttaccaaggttgtgggacatcca
aaacctgtggtcaaatggtatcgcagtggaaaggagatcttggcagatggaacaaaaata
aaagccctcgagttcaagggtggctactaccagcttgtcatcactgctgctgaggaggac
gatgcctctgtataccaagtcagagcaaccaactcctcaggatctatctctacaacagca
aacctagaagtggaagtcccagcaaagattcatctacctaaagagctccagggaatggga
gcagttcaagccgtgcgcggagatcaagtcaccatcaagatccccatctctggaaagcct
gagccagcagtcacatggcagaagggtcaggagatcctgtctaactctctttatcaccaa
gtcatcactactagatctttcacatctttggtgttccagaagggagtacagcggagagac
actggctactacattattactgccaagaacagatttggaacagacaaacaaaccattgag
gtaaatgtggcagacattcctgatgctccaaagggactcgtggtcaacgatattgcccgg
gattccatcaccctgacctgggagccccctgccaatgatggtggcagtgatattatcgga
tacattgttgagaagtgtccaaccactgcagacaggtggatccgtgctggtcacactgat
gactgcagtatcaccatcatcaatatatttggaaagaccaaataccaattccgtgttata
gcagagaaccagtttggcctgagtcctccttctgtgccgactgagcccatcaccaccaag
gaagacaagtctgtgatcaggaactacgatgaggaagtggatgaaactagagagatcacc
aaggatgaggccctattctataaggtgaaggagctgtcctccaagtacatcatttcagag
gagcttgctcgctgccagtttggagtagtccaccgctgtgtggagatcgccacaaagaag
accttcatggccaagttcatcaaagtcaaaggaactgatcgcgagttggttctcagggaa
atagaagcccttaatgttgcaagacacaagaacataatctatctgcacgaatactttgaa
agcatggaggaaattatactgatctttgaattcatctctggagttgacatctttgagcgc
cttggcaccagtaactttgagctctcagagcaggagattgttcgctacctgagacaagtc
tgctctgctctcaagttcctgcacagccagaactttggccactttgatatccacccagct
aacattgtctacactaccaggagaagttccagcattagaattattgagatgggccagtct
aggttgctggtaccaggagaaaacatcagaatgctgttctcagctccagagtactatgca
ccagaggttcaccgccatgatctggtcacaacagccactgacatgtggtctgttggtgtt
ttagcttatgttctactcagtggccttaatccatttgctgcagagtccacaaccaagatg
attgagaacatctctaactgtgagtacctctttgatagggaagcatttaaagacatcagc
ctggaggctatggacttcatagacagacttctggtcaaggacagaaagctccgtatgact
gctcatgaggctctggagcacccatggctcaagatgaagattgagaatgtcagcaacaag
gtcatcaggacactgagacacagaaggtattatcagtctctggtgaaaaagactgatact
atagtctcagcagctcgtgtggcctacggaggtgccttcaggaaccagcgaggactggat
gttggtagagtgaagattggaactgagtaccatggccttcgtgctggccctgtcatgcat
ggttcagctgaggaaggcggccatgtcagattcacctgtatccttgtcagctatgataag
agcacccaggtgtcatggtacttcggtaaccgtcagctacacccaagtcctaagtatgag
atttcctacaacaatggttttgccagcatttacgtaaaggacattgaagagagtgatgat
ggtgtctacagatgcaaagtggtaagtgatgatggagaggccagtgcctatggagaactc
tttgtagaaacagtgaggagcatcagagaatactacatgagccgcaccatcaagaaactg
aggaggtgggttgacaaatccaaactcctgcagagaccaccagagttcactctgcctctc
tacaaccgcactgcttatattggtgaagatgtgcgctttggtgttacaattaccgtccac
ccagagccccatgtagcatggctcaaaaatggagaacaactcaagcatgacgacagcaag
tacacgttcaccagcgataagggcctgtaccagctcctgattcacaacctggacattagt
gatgatgctgaatacacggtcatggcccacaacaggtttggggaagacagctgcaaggct
cgtctcagtgtgatacctcatcctgtcacagaggaaactttgaggcccatgtttaaacgt
ctgttggctaacgttgaatgcgtagagggagagagtgtttgctttgagctcagagtttca
ggagttcccagtccaactctaaaatgggaaaaggacggtcatccactacagtttggtcct
aaagttgtggtcatacaggaggacatcgattaccatgtccttcacattagggagactctg
ctggaggacgctggtgtatacaaagttactgcagctaactcggctggctcagcaagctgc
caggccacattaaaggtggaccgcattacttacacaagaagagaatacaagagcgaggag
gaaaaacacagacatgtacagaaacaaatagaaaagaccaacaaaatggctcagcacatt
gctgctactgaggagcttgtacctcttaacccaacagcacaggaagctctcaaatttgct
gcagaagtgtacaaacctgcagtgagcaccaagaacattgagggtgagttcgacatcaca
gaggagaagacagagaccaagaagctagaggaggagagaaggattttcttgccctatgag
attccagtgcctgtggttcatgatcccaaagctctggatgaagacaaagccatcaagcag
tttgtgcctctgtctgacatgaagtggtatcgcaagctgagagatcagtatgagattcca
gaaagaactgagaggattgtgcagaggaggcagagacgtatccgcctgtccaggtgggag
cagttctacgtcatgcccctccccaggatcacagaccagtacagaccaaggtggcgtatt
cccaaactcaccctggatgatttagagactgtcaggcctgcacgccggtcaccctctcct
gagtctgaagcttccttcagatccagaaggagatctctgggtgacctcagtgatgaagag
ttgctgttgcctgtggatgactacctcaccatgaggaaaacagaggaggagagactgatg
ctggaggatgaactggagctcgggttttcagcctcgcctgccggcagccctgtccgtgtc
caacgccatgccctggaacacgaggagaggaggctggaggtcagacatgcggccgcagag
gtcactgagacaaagaagaaacgcaccatttctcagtatatgagaaggagaaggtctctg
tctcccacatacattgagctgatgcgtccagtctcagagctgatcagaccgccacatgcc
cggcctcctgttgaggcagagggagaggtcgtggaacggagatcccccactccagagagg
acccgcccccgttctcccagtccagtcaagtcagtagagaggtcatcccgctcctcctcc
aggtttgagcgttcggcccgctttgacatcatgtcccgctatgaagctaggaaagcagct
ctgaagtctgagaggaaataccaggttgttagtcagacacctttcagtctggaccatgct
ccccgtgtaaccgttaggatgcgctctcaccgcatcccactcggccaagacaccaaattt
accttgaacatccaagcaaagccagaggctgaagtctgctggcttcacaatggaagtgaa
atctcagaaagcagtgaaaaatacatcttcacaaatatgagtggtgttttgtccatcact
atcctagactgtcaggaagaggacagcggcacgtaccgttgcatgtgctccaactcaagg
ggagaagcatcagactacgccaccctggaggtgtatggtggtggctacaccacattctct
tcacgtcgcagggatgaggaagttcctaaagctcatgtccctgaagtctctcgaattgac
cattatcacaccacacacttcaaaactggctatacctcccaaacgcactttgaagttgaa
gagagcaagtcaaagctaactgagacacatgaggttgtttcacgtgaaagatttggtgct
tcttctgagaggttctcctctgctgagaggtatgactcctctatcaagtatgcctcggct
gaatacctctcatcaagttcttcatactcatcggagaagttctcttcgactgagaaacat
gtcacctctgaggctaaactgaaatcttcatctactactgttgctgaccaagttactgtc
gctgaccaagttactgtccgcaaagagaaaccttctgttccagccaaaatcctgacaaag
cccaagtctgtgactgtaaacgagggagagacagccaggttctcctgtgacatcgatggg
gaacctgcacccactgtgacgtggatccatgagaggacaaccattgtatcatctcaacaa
atccaggtcaccacaacccagtacaaatccagcttggagatcacctcagtcagggcctca
gatgagggcagttacaccgtagtggtagagaactctgcaggtcgacaggaagctgccttc
actctgacaatccgcagaccagctccgaaagaggaggtgaaagctgtcaaacaccctgag
ccgcctgtgaagacacctacacctgttgttactaagtcacccgagcctgctccctctatt
atttcccccgctcccagtgtgaagtcaccagaaccatcagttaagtcccctgaaccaagt
gtaacatctcctaccccaagtataaagtcaccaactccaagcgtgaagtctcctgaacca
gaggaagttaaaccttcaaagagtgtgaaatctccagagccaccagcaccttctcctgca
cgcagtctaaaatctccaacccctggtgtaaaatcaccagaaccagaaggagttaagtcc
ccacgtggtctaaaatctcctgaaccccgactcaagtcaccaacaggaatcaagcctcct
ggaagtgtaaagtcatcagaacccgaggaggtaaaatcccctcgaggtcttaaatctcca
gaacctgcaggaatcaaaacactgagaggtcttaagtccccagaaccagcaggaatcaaa
acacaaaaaggcatcaagtccccagaaccttctggaatcaaatcaccaagagccttaaag
tctcctgagccagagggaagcaaatcaccaccaagggtgaaatctcctcctcctatcatg
tcccccaaaagggtcgtgtctcctcccactgtgaagtcgccgattcccaaacctcccaaa
gtgctgagtcagctaaccgccgaggcctgcgagggttcggtcaggatgtcctgcgtctgt
gagagcagcgtcggagaggtgacgtggtacgtaaatggaaggaggctgtcacagagcagc
cgcttcgagatgcactactctgagggttcctgcagtcttctgatccatgacctgacagac
agcgatcagggagagtacgcctgtgagatgacctcagaaggaggagtatctaaatcctcc
ttttccttcaaggggcaggtgtttcagtccatacacaagaagatcacagcctaccgtgag
cagcaagtggcactcaaagcaggatcgatggtgagtcacaaggagtcatcctcatccatg
agttcatccatgatggcgaagaaagaaatccacacaatggaggagtcttcgtcgttttct
tctgcttcagcccatcagacaatgatgtcctccatgatggagtccagctccttcagcagc
atggcagcagagatgaagtttgagaccatgtcaatgtccagcatgtcctccatggcatct
gaaacgtatgccatgagttccagcagcctcacagagatgacttcccaattagaaggatct
tcactgagagcaatcggttctgctccaagaatcgaagctctgccagaggacatcagcatc
gaaccaggaaaagtcctgacagtcgcctgtgccttctccggtgatgccaaaaacatcgag
tggtcctgcggcggtaaaaccatcgtggtgactgctggcggacgcttccacatcgagacc
acagatgacctgaccaccctcatcatcactggagtgaagcaggaagacgccggagcctac
acccttaaactgtccaacgaactcggatctgacacagcgactgttcacatcagcattcga
tcagtgtaa

DBGET integrated database retrieval system