KEGG   Kryptolebias marmoratus (mangrove rivulus): 108248092Help
Entry
108248092         CDS       T05608                                 

Definition
(RefSeq) glutathione S-transferase theta-1-like isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00480  Glutathione metabolism
kmr00980  Metabolism of xenobiotics by cytochrome P450
kmr00982  Drug metabolism - cytochrome P450
kmr00983  Drug metabolism - other enzymes
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    108248092
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    108248092
   00982 Drug metabolism - cytochrome P450
    108248092
   00983 Drug metabolism - other enzymes
    108248092
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kmr02000]
    108248092
Enzymes [BR:kmr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     108248092
Transporters [BR:kmr02000]
 Other transporters
  Pores ion channels [TC:1]
   108248092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4 Tom37 Tail_P2_I
Motif
Other DBs
NCBI-GeneID: 108248092
NCBI-ProteinID: XP_017292086
UniProt: A0A3Q2ZV61
Position
Unknown
AA seq 228 aa AA seqDB search
MATGRLVDVYLDLLSQPCRAVYILLTCTKIPHRVHTVALRKGENKTPEFTRLNPMQKVPV
MVDNGFVLTESDAILKYLASTRDVPEHWYPRQPEQRARVDEYTAWHHTNTRLRAAKVFIL
EVLLPAQFGAPVDKTRLKRALSELEDTLDKLESMFLRRQPFLCGDDVTVADLLAVCELMQ
PLGGGRDILKDHPQLQRWMSRVQSAVGESFDKAHAVLYGIRDRHRAKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgggtcggctggtggacgtgtacctggacctgctgtcccagccgtgccgggcg
gtgtacatcctgctcacctgcaccaagatcccgcaccgcgtccacaccgtggctctgagg
aaaggagagaacaagactccagagttcaccaggctgaaccccatgcagaaggttcctgtc
atggtggacaacggtttcgtcctcacagagagtgatgccatcctcaagtacctggcctcg
acgcgcgacgtccctgagcactggtatccacggcaaccggagcaacgagcccgcgtggat
gagtacacggcctggcatcacaccaacacgcgcctgagagctgccaaagtcttcatactg
gaggtgctgcttcctgcgcagtttggcgctccggtggacaagacgcgtttgaagcgtgct
ctctcagagctggaggacacgttggacaaactggagtccatgttccttcgccggcagccg
ttcctctgcggcgacgacgtcaccgtggccgacctgctcgccgtctgcgaactcatgcag
cctctgggtggggggcgggacatcctgaaggaccaccctcagctgcagcgctggatgagc
cgcgttcagtcggccgtcggcgagtcgttcgataaagctcacgccgtcctgtacggcatc
agagaccgccaccgagccaaactgtga

DBGET integrated database retrieval system