KEGG   Kryptolebias marmoratus (mangrove rivulus): 108248619
Entry
108248619         CDS       T05608                                 

Definition
(RefSeq) adenylate cyclase type 4-like isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00230  Purine metabolism
kmr01100  Metabolic pathways
kmr04020  Calcium signaling pathway
kmr04114  Oocyte meiosis
kmr04261  Adrenergic signaling in cardiomyocytes
kmr04270  Vascular smooth muscle contraction
kmr04371  Apelin signaling pathway
kmr04540  Gap junction
kmr04912  GnRH signaling pathway
kmr04914  Progesterone-mediated oocyte maturation
kmr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108248619
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    108248619
   04020 Calcium signaling pathway
    108248619
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    108248619
  09144 Cellular community - eukaryotes
   04540 Gap junction
    108248619
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    108248619
   04914 Progesterone-mediated oocyte maturation
    108248619
   04916 Melanogenesis
    108248619
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    108248619
   04270 Vascular smooth muscle contraction
    108248619
Enzymes [BR:kmr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     108248619
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 108248619
NCBI-ProteinID: XP_017292988
UniProt: A0A3Q2ZNN2
Position
Unknown
AA seq 1285 aa
MPDESQSFQDRLKPEGEAPQVSLVPSVVVISCNEKDKGNILELHDLKQPAHSSDTNILKG
NGSSASLPGESQLALGVSQISIQVGEVKTAHAPEPLKTISLMKGREMTSQRTDNDAPVTL
SCNKLQHDSCTDSDYSSAKSSPGFACVGESLELNGKSFEKTSSISPINLSENSLDKSNNI
SKNSLDDDRYSSSSNIRSIRNSLSSVQFSNKTRNSMDIRSTEGNEDDDWRSTRSRRSVKE
GVCCCYQTTSRAFLRCVEETPAMLSGLLLCLIFCVVIIVLIPATGRFTPQNRGDHVGALS
VVCVVLCLSALLLVCMPWLATIRRCGGALALFIWGMLYTIAMVFVFTGGHVTAWEQVAFF
LYLSLSVYTVLPLSLAWALMIGIGTSVSHIIIISVYVPVTRPGTPELAEQLVANAVLFIC
VNCIGFFHMWMAKRGLRKSNQKREDYSAIRVQKEVRNYQQEGLLLSVLPRYIAVQLKEEV
IKKLSKSKGQKDNETSLSNFHSLYVENHKNVSILYADIVGFTKLASTCSPEELVSVLNKL
FGKFDDIAKKNGCLRIKILGDCYYCVSGLPDPIPTHADNCVQMGLDMCTAISDLRDVTQV
DINMRVGVHTGNVLSGVIGLQKWQYDVWSDDATLANQMESGGVPGRVHITEETLQHLKKN
YKVEDGNGESRNPLLKGRKTFLVIDPNSISQSPKARNRLILEENSKRASLRMSQYLQAWK
TVNPFEELSNPDKKKLFKPLKVAIKRPQLVQEEQSHCENPNRLSVDSSVRGSLDTVDIVG
RKTKKLNWLTLLFKDFSLEKEFRFSEVRDVHHSMSCMAAIFVTLFTVQMLVSEKNYQIGV
SYGVTFPVMVLLLAIALTEHLEKMRSKIPLNAQWISHLSRSVSTRVVLRLFVVVLCVLIT
LLMAFLNLIFLQGDNCTSVANTTELEGIRLYTVPYYLYCCLLAMLGVIVFIKISFSVKGL
LLTLAVVVYLALFLDVYAPRSQCLIDLLYNGTNRPGVLKDPQIMSGVWLVIFYFVCLILA
RQDELTCRVDFLLDRCFKTEQEEMETIENINKLLLDNVMPPHVGSFFMGKTVSNQDLYSQ
SYECVCVLFASIPQFKDFYTESNVNGDGLECLRLLNEIIVDFDELLIKPKFSSVEKIKTI
GSTYMAAVGLTHLPQGEDNKKVDMTYSHVRSMLEFAIAMMSKLEQNNSHSFNNFKFRIGI
NHGPVIAGVIGAHKPQYDIWGNTVNVASRMDSTGVLDKIQVTEETSQIVQSIGYDVTFRG
VINVKGKGELKTYFVNTSSVRLELS
NT seq 3858 nt   +upstreamnt  +downstreamnt
atgccagacgagtcacagagttttcaggaccggttaaagcctgaaggagaagcaccacag
gtgtctttagtccccagtgttgttgtcatctcctgcaatgagaaggacaaaggtaacatc
ttggagcttcatgacctcaaacaacctgctcacagcagcgacacaaacattttaaaagga
aatggcagcagtgcgagtcttcctggtgagagccagttggcactcggtgtgtcccagatt
tcaatacaggtgggagaggtgaaaacggcacacgctcccgaacctttgaaaaccatttcc
ttaatgaagggaagagaaatgacctcgcagagaactgataacgatgctcccgttactttg
tcctgtaataagctacaacatgacagctgcactgattcagactacagcagcgcaaagtcc
agtcctggattcgcctgcgttggagagtcactggagcttaatggaaaatcatttgagaag
acaagctccatttctcccatcaacctgtctgaaaacagtttagacaaatcgaacaacatc
tccaaaaacagcctggatgatgataggtacagctcctcctcaaacattagaagtataaga
aactcactcagttcggttcagttcagcaacaaaaccaggaacagcatggacatcaggtca
accgaggggaatgaagacgatgattggcgaagcacgaggtccaggcggagcgtgaaagag
ggtgtgtgttgctgctatcaaaccaccagcagggctttcctgcgatgtgttgaggagacc
cctgccatgctgtctggactgctgctgtgtttgatcttctgcgtggtcatcatcgttctc
attcctgctacaggacggttcactccgcagaacaggggcgatcatgtcggtgctctgtca
gtggtgtgtgtggttctctgtctgagtgccctactgctcgtctgcatgccctggctggcc
acgataaggcgctgtggaggagcactggcgctattcatctggggtatgctgtacaccata
gccatggtcttcgtcttcacgggagggcatgtcacagcatgggaacaagtagcgtttttc
ctttacctctctctgagtgtgtacactgtgctgcccctctctctggcctgggccctcatg
attgggatagggaccagtgtttcccacatcatcatcatcagtgtatatgtccccgtcacc
agaccaggcacaccagagctggctgagcagttggttgcaaatgctgtactgttcatttgt
gtgaactgcatcggattttttcacatgtggatggccaagagaggtctgaggaaatccaat
cagaagagagaagattacagcgccatacgcgtgcagaaggaagtcagaaactatcagcag
gaggggcttcttctgtcggtgttgcctcgctacattgccgttcagctgaaagaagaggtg
attaagaagctatccaagtccaaaggacagaaggacaatgaaaccagcctgagcaacttt
catagcctttatgtagagaaccacaaaaatgtcagcatcctgtatgcagacattgtgggc
ttcacaaagctggccagtacctgttctccagaggaactggtttctgttctcaacaagctt
tttggcaaatttgatgacattgcaaagaagaacggctgtcttcgcattaagatcctgggt
gactgctactactgtgtgtccggtctgccagaccccattcccacccatgctgataactgt
gttcagatggggctggacatgtgcactgccatcagtgacctgcgagacgttacacaagtg
gacatcaacatgagggttggcgttcacactggtaacgtgctctccggtgtgattggcctg
cagaagtggcagtacgacgtgtggtcagatgatgccacattagccaatcagatggagtca
gggggtgttcctgggcgagtgcatataactgaggaaacactgcagcacttgaaaaaaaac
tacaaggtggaagatggaaatggagaaagtcgaaatcctcttcttaaaggaagaaaaaca
tttcttgtgattgaccccaatagtatttcccagagtcctaaagcacggaacaggcttata
ctagaagagaacagcaagcgggcatcgctccgaatgtctcagtacctccaggcgtggaaa
accgtcaatccttttgaagaactaagcaaccctgataaaaagaagcttttcaagcctttg
aaagttgccataaagcgaccacagctagtacaggaagaacaatctcattgtgaaaaccct
aaccgtctttctgttgacagcagtgtgaggggatcactggacacagtggacattgtaggg
aggaaaacaaagaaactcaactggttgactcttctgttcaaagacttcagcttagaaaaa
gagtttcgcttttcagaggtcagggatgtgcaccactcaatgagctgcatggctgcaatt
tttgtcactctttttacagtccagatgctcgtctctgaaaagaactaccagataggagta
tcttatggtgtgacgtttcctgtgatggtgctgcttctggccattgctctcactgaacat
ttggagaaaatgcgctctaagatacctctgaatgcccagtggatatcacatttgtcgcgg
agtgtctccaccagggtggtgctgcggctctttgtggtcgttctctgtgtcctcatcacc
ttactcatggccttcctcaacttgattttcctccaaggagataactgcacctcagtggct
aacaccacagagttagaaggaatcagactgtatactgtaccttactacctgtactgctgc
ctgctggccatgctgggagtcatcgtgttcatcaagatcagcttctctgtgaaggggctg
ctcctcactctggctgtggtggtttacctggccctcttcctcgatgtttacgctccgagg
tcccagtgcctcattgacctgctgtacaatggcacaaacaggcctggagtcctgaaggac
cctcagatcatgtctggggtttggctggtcatcttttacttcgtgtgcctcatactggcc
agacaggatgagctgacttgccgtgtggatttcctcctggaccgctgtttcaaaacagaa
caagaggagatggagaccattgagaacatcaacaagctgctgcttgacaacgtcatgcca
cctcatgtcggctctttcttcatgggcaaaactgttagcaatcaagacttgtacagtcag
tcatacgagtgtgtgtgtgtattgtttgcatcgatacctcagttcaaagacttttacact
gagagcaacgtcaacggggacggtctggagtgtttgcgcttgctcaatgaaatcatcgta
gactttgacgagcttctgataaagcccaaattttcgtctgttgagaagattaagacgatt
ggcagcacctacatggctgctgtagggctgacacacttgcctcaaggagaagacaataag
aaagtggatatgacctacagccacgtgcgctccatgctggagtttgccatcgcaatgatg
agcaaactggagcaaaacaattctcactcctttaacaatttcaaattcaggattggaata
aatcacggcccagtgattgcaggagttatcggagcccataaacctcagtatgacatctgg
gggaacactgttaatgttgctagcaggatggacagcacaggagtgctggataagatacag
gtgacagaggaaacgtctcaaattgtccagagcatagggtatgacgttacgttccgtgga
gtgatcaacgtgaagggcaaaggggagctcaagacctacttcgttaacacctcctcagtc
cgacttgagctgtcatga

DBGET integrated database retrieval system