KEGG   Kryptolebias marmoratus (mangrove rivulus): 108250317Help
Entry
108250317         CDS       T05608                                 

Gene name
thnsl2
Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108250317 (thnsl2)
Enzymes [BR:kmr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     108250317 (thnsl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP HTH_20
Motif
Other DBs
NCBI-GeneID: 108250317
NCBI-ProteinID: XP_017295633
UniProt: A0A3Q2ZIZ5
Position
Unknown
AA seq 489 aa AA seqDB search
MLYCSTRGGVHGWDFKDVLFSGFAPDGGMFMPESVPVLSPETLRSWRGLSYSQLVVDVSS
LFIPAQLIPRDHLEALVLKALSGFSVPEVVRTARLRDGLSVLELFHGATLAFKDLAMSCT
VHFTDYFLQKDKRRAVVLVGTSGDTGGSAIHSSKGLPGLDVLVVYPQGRITAVQEKHMVS
CLEDNVHVFAAAGSSDDIEQPLRRLFADQDLVSSHGLMSLNSVNWSRVMVQIAHFLYAYL
ELSGVESAAEGAELPELEVVVPTGGAGNITAAYILKVMGVPLRLVAMVNSNDIVHRAVTS
GDFSMASSVARTLAPAIDIQDPYNLERIFWLLLDKDGASVKTIMEEFQRSHQHRLSERLH
QLLSEVLLTGTVSDQEILETMRRCWEENRYVLCPHSAVAVWHHYHHPHPAQLKRCYIATA
SPAKFQAAVEKAGLTFDLPEEVRALDHKPTRYQNLERSQNWCKDWEDKLRDWIQFVSSVR
KSSGVCYSQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgctgtactgcagtactcgtgggggggtccatggatgggacttcaaggacgttctgttc
tcaggttttgctccagatggaggcatgttcatgccagagtccgtccctgtcctcagtcct
gagaccctgaggagctggaggggactgtcctactcccagctggtggtggacgtctcctcg
ctgtttattccagctcagctgatccccagagaccacctggaggctctggtcctgaaagcc
ctgtcgggtttctcggtaccagaagtcgtcagaaccgctcggctcagagacggtctgtcg
gtcctggagctcttccacggagcaacgctggccttcaaggacctggctatgtcctgcacc
gtgcacttcactgactacttcctgcagaaggacaagcgccgagccgttgtcctcgtggga
acatccggagacaccggcggctcggccatccacagctccaaaggtcttcccggtctggat
gttctggtggtttatcctcaggggcgcatcaccgcggtgcaggagaaacacatggtcagc
tgtttggaggacaacgtccacgtgttcgcagctgccggcagctcagacgacatcgagcag
ccgctccgccgtctcttcgccgatcaggacctggtctcgtctcacggcctcatgagcctc
aactccgtcaactggtcccgagtcatggtccagatcgcccacttcctctacgcctacctg
gagctcagcggggtggagtcggccgcagagggggcggagctgccggagctggaggtggtg
gttccgaccggcggtgccggaaacatcacggctgcttacatcctgaaggtgatgggcgtg
cctctgaggctggttgccatggtgaactctaacgacatcgttcaccgggcggtaaccagc
ggtgacttctccatggcctccagcgtcgcccggactctggctccggctatagatatccag
gacccgtacaacctggagcggatcttctggctgctgctggacaaagatggcgcctcggtg
aagacgatcatggaggagtttcagcgttcccaccagcaccgcctgtctgagcggctccat
cagctgctgtccgaggttctgctgaccggcaccgtgagcgatcaggagatcctggagacc
atgaggaggtgctgggaggagaaccggtatgtgctgtgtcctcacagcgccgtggccgtg
tggcatcactaccatcaccctcacccggcccagctgaaaaggtgttatattgcaacggca
tctccagccaagttccaggcggcggtggagaaggcaggtctgacctttgacctcccggag
gaggtgcgggccttggaccacaagcccactcggtaccagaacctggagaggagccagaac
tggtgcaaagactgggaggacaaactgagagactggatccagtttgtgagttcggtcagg
aagagcagcggggtttgttacagtcagtga

DBGET integrated database retrieval system