KEGG   Kryptolebias marmoratus (mangrove rivulus): 108250794Help
Entry
108250794         CDS       T05608                                 

Definition
(RefSeq) poly [ADP-ribose] polymerase 14-like
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    108250794
Enzymes [BR:kmr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     108250794
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP WWE NeuB
Motif
Other DBs
NCBI-GeneID: 108250794
NCBI-ProteinID: XP_017296327
UniProt: A0A3Q3GGB6
Position
Unknown
AA seq 1612 aa AA seqDB search
MDGPDGFPVFFECPSLNEEQKKRVENYFRIKRKSGGGECSSVTEVEEKVYSVVFKERDAQ
QRVLQKPKHELEVEGGPLVLTVRDNPGPNKSHNTTPTSEKLTNPKQDLTSSQQNLESSLL
SSLSPSGEEYELQLDSYVFRYLKECPKAKTELEKKLASASCSAQFHSEEDKFLVRLLAQP
GAVGAGAAEVSNWKSEVDKLFDSYLSHYELDPHKIKALLESCSSDQSTGEVKVYSEIGMA
VVVGEYSQVKARLTESLCVKHRGSSSGDSKTAVRRLGEAKLRLLRKEIESSLGEKFPKVK
VTQADEGKLLLEGSVDDILKASELISEKENLVFERTVSDKTPHFLAFLKQVYGGPGMLCD
ILGAGDKVEVELRDTELHFFSLNANKLDESEKKMEEKFSEVKYDIPNCFVVPPELREKLK
SKTNEMNQKECRAKVVFGADNTVYLLGHTKEVEELSDAVIEFILDQSSIEARVELPFPEL
VQLLPELLQLHNFDFSGVTFSPLTAYSRPTVVLEGSANNVAEVKNRLGLFLDSIVQDKVT
IEMAGAVRFFDCHAGRESLLKVAHAHKCLIQLEEQPHISRHNLGFAKYNLQHGLQVLVCE
GDITKQDADALVNAANGDLNHIGGVAAALSKAGGPQVQKESKTIVKQTGKIPTGKVVVTT
GGNLKCKALLHAVGPVGGKESGRERIMLEKTVHNVLNLAEMMEFKSIAMPCISSGVFGVP
IRVCSDAIVTAIKTFDSQGGRSLSKIVLIDNRVEVVRAMQEACDRLLQEKGTRRSTQGDV
GFQINEGAAGGATAGSAADTVLVEIVQGTIETQQVDAIVSPMASLNPVSTNIGQALASVV
GPQLTAKFHKEAGGATLPGDTVVVESLPGLKCKTVIFLNLDRWDNTQDGAPVQELRQGMK
KVLASCEIRGFSSVAFPVLGTGALLHFPHKLASNVLLEEVRAFEQNRISKTPFLVRIVVH
PKDKESSKAFQSTQGALHLRGFTNDVNPNKASFYRHVSVKNDEVTALLGGVTLEIVCGDI
TKAGTDVIVNTTGFLKQHSGVSKAILTAAGPSVHAELAKVGIPADMMCTTGPGLLGCKEI
IHADFQGDPQLTLKNCKKILAQCESKGFRSVAFPAINTGQAGMSYDTACKAMLDGIASAI
TDLRPNSLSLIRIVILQQPVFQAFRSELENRFGQIVRLSLKENARQKLKMLQEKCSVTFS
TSSASQSQSFISSKPQPAVLRVISCGQDINKSIKTDLEEFLQKALLERTVDVHEFSKLNA
MEMDAVLARISLAGISLDHKKHQSSQRVNVGLGERDQSGSGKDVYVLKGLAEDVLSVTEL
INKAVHKALEDDLKDKEEAMMALTVQWGIKDDSGEWQELNLRDNYMLENAHLTKQVSVEM
ETPDTRMVRVNLKTLEATDWVTGKTYKLKRTESQTDLELPQHWESMHGQYFKKVELQHYS
SEYQKVATDFLKTAKYSIHKIERVQNVFLWQAFSVCRQRIIAKNGSAELHEKFLYHGTSA
ESCNCIERDRFDRSYAGTHAAVYGKGVYFAVNAKYSADTYSPADVSGLKRLYVARVLVGR
YTVGNSSMKAPPPRGSDPTDCFNSLVDNQQHPSMFIIFHDDQAYPEYLITFR
NT seq 4839 nt NT seq  +upstreamnt  +downstreamnt
atggacggtccggacgggtttcccgttttttttgagtgtcccagtctgaacgaagagcaa
aagaagagggtagaaaattattttcgcatcaagcgcaaatcaggtggaggagagtgcagc
tcggtgacggaggtggaggaaaaagtttatagcgtcgtttttaaagagcgagacgctcaa
caaagagttctacagaagccgaagcatgagctggaggtggagggtggtcctttggtgctg
actgtgcgagacaatccaggacccaacaagtctcataacactaccccaacttcagaaaag
ttaacaaacccaaaacaggatttaacatcatcacagcagaacctggagtccagtctttta
tcaagcctgtcaccaagtggtgaagaatatgagctacagctcgactcgtatgtctttcga
tacctgaaggaatgcccaaaagctaagacagagctggagaaaaaacttgcctctgcatcc
tgctctgctcagtttcattcagaggaggataaatttttagtcagactattagctcaacct
ggtgctgtaggtgctggtgctgctgaggttagtaactggaaatctgaagtggacaaattg
tttgatagctatttgagccactatgagttggaccctcacaaaatcaaagctttgctggag
tcctgcagctctgaccagagcacaggtgaggtaaaggtctacagtgagattggaatggct
gttgttgttggagaatattcccaggttaaagctaggttaacagaatctctatgtgttaaa
cacagaggatcatcctcaggtgattcaaaaactgctgtccgtcgacttggtgaggctaaa
cttcgcctcctccggaaagagattgagagcagtttgggggaaaaatttccaaaagtgaag
gttactcaggcagatgaaggtaagttgttgttggaaggctctgtggacgatattctaaag
gcgagtgaattgatctctgaaaaggagaatctggtattcgagagaactgtttctgacaaa
accccacattttttggccttcctaaaacaagtttatggtggtccaggcatgctttgtgac
attttaggagctggtgacaaagtggaagtagagttgcgagacacagagctacacttcttc
tccctcaatgccaacaaactagacgagtcagaaaaaaagatggaagaaaaattcagcgag
gtcaaatatgacattcctaactgctttgttgtgccacctgagcttcgggaaaaactgaag
tccaagacaaatgagatgaaccaaaaggagtgcagggctaaggttgtatttggtgctgac
aacacggtgtatttactgggccacactaaagaggttgaagagctcagtgatgccgtcatt
gaatttattttggaccagtcaagcatagaggccagagttgagctccctttcccagagtta
gttcaactcttaccagaattgttgcagttacataattttgacttttcaggcgttaccttc
agccctctaacagcgtattctaggcccactgtggtgctcgaaggttcagccaacaatgtg
gctgaggtcaagaatagactgggactatttctggactccattgtgcaagacaaagttact
attgagatggcaggggcagttcgattttttgattgtcatgccggaagagagagcctctta
aaggttgctcatgctcataaatgtctcatccaacttgaagaacagcctcatataagcaga
cataatttgggatttgccaaatataaccttcagcatgggcttcaggtgctggtttgtgaa
ggtgacatcacaaaacaggatgctgatgccctggtgaatgctgccaacggagatctaaat
cacattggtggtgttgcagctgcactgagtaaagctggtggccctcaagtgcagaaagaa
agcaaaacaattgtaaaacagactggaaagatccctactggtaaggtggtagtgactaca
ggaggtaacctaaaatgcaaagcactgctgcatgctgttggacctgtaggtggaaaagaa
agtggcagagagaggattatgctagagaagactgttcacaatgttcttaatttagctgaa
atgatggagttcaagtctattgccatgccatgtataagctcaggtgtgtttggtgttccc
atccgagtgtgctctgatgctattgtaactgccatcaagacgtttgatagtcagggtggg
cgaagtctgagcaaaatcgtactgatagataacagagtagaggtggtgagagccatgcag
gaggcatgtgacaggcttctccaggaaaaaggtaccagaagaagcacacaaggagatgtg
ggattccagataaatgaaggagcagcagggggagccactgctggatctgctgcagataca
gtcctagttgagattgttcaagggaccattgagacccaacaggtggatgccattgtatct
cctatggccagtcttaaccctgtctctactaacattggacaagctttggccagtgtggtc
ggaccacagctgacagcaaagtttcataaggaggcagggggagcaacactgccaggtgac
accgttgttgtggaaagtttgcctggtcttaaatgcaagacagtcatctttctcaaccta
gaccgctgggataatacccaagatggagctccagtccaggaactgaggcagggaatgaaa
aaagtactggcttcctgtgaaatccgaggctttagttcagttgcttttccagtgcttggg
actggtgctctactgcattttcctcacaagctggcttccaatgttcttctggaggaagtc
cgtgcatttgaacagaaccgaatcagcaaaacaccttttctggtccgtattgttgttcat
cccaaggacaaagaatctagcaaggccttccagtctacccaaggggccttgcatctcaga
ggattcacaaatgatgttaatccaaataaagcttctttttaccgtcatgtctctgtgaaa
aatgatgaagtcacagccttgctgggtggagtcacacttgagattgtctgtggtgacatc
accaaagcaggaacagatgtcattgtcaacacaactggcttcttaaagcaacattctggt
gtctccaaagctattctgactgcagcagggccatctgtccatgcagaattagccaaagtt
ggcattccagcagatatgatgtgcaccacaggtcctgggttgcttggttgtaaggaaatc
attcatgccgactttcaaggcgaccctcagttaactctcaaaaactgcaaaaagatactg
gcgcagtgtgagagcaaaggattccgctcagtggccttcccagccattaatactggacaa
gctggtatgagctatgacacagcttgcaaagctatgctggatggtatagcttcagctatc
acggatttgaggccaaattctctttccctcatccgcattgtcatcctgcaacagccagtc
tttcaagctttcagatctgagctggagaatcggtttggacaaattgttcgtctgagcctc
aaagaaaatgctagacaaaaactcaagatgctgcaagaaaagtgttcagtaacattttca
acatcttcagcatcccaaagccagtcatttatctcctcaaagccccagccagcagtgtta
cgagtaattagctgtggtcaagacatcaacaagagcatcaaaaccgatttggaagaattc
ttgcagaaagcgctgttggagcgaacagttgatgtgcatgagttctctaagctaaatgcc
atggagatggatgctgtgctggcaagaatcagtcttgctggaataagcctggaccacaaa
aagcatcagagctctcagagagtgaatgttggacttggagaaagagatcagtctgggtca
ggaaaagacgtgtatgtgctgaaaggcttagcagaagatgttttgagtgtcactgaactg
ataaacaaagcagttcataaagccctggaagacgacctcaaagataaggaggaggcaatg
atggctcttactgtccagtgggggataaaggatgacagtggagaatggcaagagttgaac
ctgcgtgacaattacatgctagagaatgctcacttgacaaaacaagtgtctgtggaaatg
gaaacaccagataccaggatggtgagagtaaatctgaagacactggaagccacagattgg
gtgacaggcaaaacatacaaactgaaaaggactgagtcacaaacagatttggagctgcca
caacactgggagtctatgcacggacaatactttaaaaaggtagagttacagcattactca
tcagagtaccagaaagtagccactgatttcctcaaaacagctaaatacagcattcacaaa
attgagcgtgtgcagaatgtcttcctttggcaagcctttagtgtttgtcggcagcgtata
attgccaaaaatggttcagcagaacttcatgaaaagtttctctaccatggcacatcagca
gagtcatgcaactgtatcgaaagagacagatttgacaggagttatgctggaacacatgct
gctgtatatggaaaaggggtatactttgcagtcaatgccaaatactcggctgacacatat
tccccagcagatgtgtcaggcctgaagcggctatatgttgctcgtgtccttgtgggccgt
tatacagtcggtaactcctccatgaaagccccccctcctcgaggttctgaccccacagac
tgcttcaacagtttggtggacaaccagcagcacccttccatgtttattatctttcatgat
gaccaagcctacccagaatacctcatcactttcagatga

DBGET integrated database retrieval system