KEGG   Kryptolebias marmoratus (mangrove rivulus): 108250805Help
Entry
108250805         CDS       T05608                                 

Definition
(RefSeq) serine/threonine-protein kinase WNK4-like
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:kmr01001]
    108250805
   01009 Protein phosphatases and associated proteins [BR:kmr01009]
    108250805
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     108250805
Protein kinases [BR:kmr01001]
 Serine/threonine kinases: Other
  Wnk family
   108250805
Protein phosphatases and associated proteins [BR:kmr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     108250805
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal XRN_M
Motif
Other DBs
NCBI-GeneID: 108250805
NCBI-ProteinID: XP_017296340
Position
Unknown
AA seq 1217 aa AA seqDB search
MMPSTSDSDTKQRPEEEEDDEEEDEEDPNLPVTMTTSKDDSAGQSDAGDKPPTGEDLGWD
SGDEAASVLSDSVQEELPWQQKKEEERDEEETKAVAASPDGRFLKFNIEIGRGSFKTVYR
GLDTETTVEVAWCELQTHCLSRAERQRFSEEVEMLKVLQHPNIVRFFDSWKSTPKGPKSI
ILVTELMTSGTLKMYVRRFRPMKLKLLQRWSLQILKGLHFLHSRSPPILHRDLKCDNIFI
NGPTASVKIGDLGLATLKKASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFGMCMLEMAT
SEYPYSECQNAAQIYRKVTNGTKPDSFTKVEVPELKEIIEGCIRTRSSERFTVQDLLDHR
FFQEQTGVHVELAEEDDGSKAALKLWLRMDDNKKLCGKYKDHDAIEFLFELYKDVPEEVA
QEMVILGFVSKVDYKVIAKAIRHRVTAIKRQREKKRRLLEEALNNQKEATNEEEPDPASQ
QPELSNQKPECASNVSAAGKAASQLQNKPPVGVQAPPTAPPTAVTSSVLSSSLVDSGMSS
RTEGDEDEDKTSKHLSPSSAASDCETGNASGAAEAPPPVPNPAPVSETSSPVNHPASKAP
PFPILRFPKSIAVSQNAEQTPPKSTHGFSSPVDSYSSDITSGLSDGYDGQSDKSKEAAKR
EAMKQFRRKARARLRIIGVSDKVDRVVECQLQTYNNKMVTFKFDLDGDNPEDIASVMLHR
DFILLSERDGFILRMYEIIKRAELMMHQQHPNTLSHLTASTLPESQLNLVTKGLYRTLSS
SSLTDMDNSSPSPLKAVDFCIDPEATPLVRPLRSQSFQTPSASSYQPPPYPLGFHPPHPQ
PLAPLFPNPHAALSPPGSPSLGSNLRPQRPSSLSTALPTQPAYPPSVPQMGSGQQGAPSS
RAANSPQGGQNQIQLINPVLKTGLAPPPTGPERVLPPSLTRTPSHLEELSSSSSSSPPST
PHKLVSPPVSPSARISPTLEVKKPAFTVGRFQVSPSKDVSSDPHQEPRPLCQATPTTHSP
PPPTRNQSESNSGSGTDESQSERANCRVTGSPSGYHDNPSAQEDRKTGSQKLSVNLWEEL
PAIPGLSGQLRSRFAIYSSDESEDEELWEELLELRQRHLLQVQMLQVTQKREMEELYWMK
GKVPPPGIVSAAAMLNHRHRRPSKSGNVPPPRKASQQRADTLPPAGIMRRSSVNGSSGGS
QDRALKGVTFASGHSCI
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atgatgccctccacctctgacagtgacaccaaacaaagacctgaggaagaagaagatgat
gaagaggaggacgaggaggaccctaaccttcccgtcaccatgacaacctcgaaggacgat
tccgccggccaatcagatgccggagataaaccccccacaggtgaggaccttggctgggac
tccggtgacgaggcggccagcgttctgtcggactctgtccaggaggagttaccatggcaa
cagaagaaggaggaggagcgcgacgaggaggagacgaaggcggtggcggcttcgcccgac
ggacgcttcctgaagttcaacatcgagatcgggcggggctccttcaagacggtttaccga
gggctggacacggagaccaccgtggaggtggcctggtgcgagctgcagacccactgtctg
agccgagccgagcgccagcgcttcagtgaggaggtggagatgctgaaagttctgcagcat
ccaaacatcgtgaggttcttcgactcctggaagtccactccgaagggccctaaatccatc
atcctggtgacggagctcatgacgtccggaaccctcaaaatgtacgtgcgcaggttccgc
cccatgaagctgaagttgctgcagcgctggagcctccagatcctgaaggggctccacttc
ctgcactcgcgctcccctccgattctgcaccgagacctcaaatgtgacaacatcttcatc
aacggacccaccgcctcagtgaagatcggagacctgggcctcgccacgctcaagaaggct
tcgttcgcgaagagtgtcatcggaactcctgagttcatggctcctgagatgtatgaggag
aagtatgacgaggctgtggatgtttacgccttcggtatgtgcatgctggagatggcgacg
tccgagtatccgtactccgagtgtcagaacgccgcccagatctaccgcaaggtcaccaat
ggaaccaaaccggacagttttactaaagtagaagtcccagaactgaaagagatcatcgag
ggctgcatccgaaccaggagcagcgagaggttcacggttcaggatctgctagaccaccgg
ttcttccaggagcagacaggtgtccacgtggagctggctgaggaagacgacggttcgaag
gcagcgctgaagctttggctccggatggacgacaacaagaagctttgtgggaaatacaaa
gaccacgacgccatcgagttcctgttcgagctgtacaaagacgttcctgaggaggttgcc
caagagatggtgattctgggcttcgtgtctaaggtggactacaaggtgatcgccaaggcg
atcagacaccgagtgacggcgataaaacgacagagggagaaaaagcgccgcctgctggag
gaagccctcaacaaccagaaggaagccaccaacgaggaagaacctgaccccgcctcccaa
caacctgaactgtccaatcaaaaacctgaatgtgcctcaaatgtgtctgctgctggaaag
gcagccagtcagttacagaataagccccctgttggagttcaggccccgcccacagcgccc
ccgacagcagtgacatcatcggtgttaagcagcagcctggtggattctgggatgtccagc
aggacagaaggagatgaggatgaagacaagacgagcaaacacctgtccccctcctctgct
gcctccgactgtgagacagggaacgcctcaggagctgcagaggccccgcctcctgtccca
aaccccgcccctgtctcagagacttcttctcctgtaaatcatccagcatctaaagctccg
cctttccccatactgcgtttccccaagagcatcgctgtgtcccagaatgctgagcaaact
ccacctaaatcaacccacggcttctcatcacctgtcgacagctactcctctgatataact
tcaggtttgagtgacggctacgacggccaatcagataagagcaaggaagctgctaaaaga
gaagctatgaagcagttcaggaggaaagccagagctcgcttgagaatcatcggggtgtct
gataaagtggaccgggtggtggagtgtcagctgcagacttacaacaataagatggtgacc
tttaagtttgacctggacggagacaatcctgaggacattgcatctgtgatgctccacaga
gacttcatcctgttgtcagagcgggacggattcatccttcggatgtatgaaatcattaag
agggcggagcttatgatgcatcaacaacatccaaacacgctgtcgcacctgacggcctcc
acgctgcctgaatcacagttaaatctggtaacgaagggtttgtacagaactttgtcctcg
tcctcattaactgacatggacaacagtagcccctcccctttgaaggctgttgatttctgc
atcgaccctgaggccacgcccctcgtcagaccactgaggtcccagtcttttcagactcca
tcagcttcctcctatcagccccccccgtaccccctcggctttcaccccccccaccctcag
cctctggctcccctgttcccgaacccccatgctgccctctctcctcctggatctccatca
ttgggctctaacctccgacctcaaagaccctcgtctttatccaccgcccttcccacccaa
ccggcctaccccccctcagtacctcagatgggctcaggccagcagggggcgccatccagc
cgggctgcaaactcacctcagggagggcagaatcagatacagctcatcaatccagtcctg
aagaccggcttggctccgccccctacaggtccagagagagtccttcctcccagtctgacc
aggactcccagtcacctagaagagctctcctcctcctcctcctcctctcctccatcaact
cctcacaaactggtttctcctcctgtttctccatcagccagaatttcacccacgctggaa
gtgaagaaaccagccttcactgtaggtcgcttccaggtgtctccttccaaagacgtttcc
tctgaccctcaccaagagccacgccccctctgccaggccacacccaccacacattcacca
cctcctcccacgagaaaccaatcagagagcaactcagggagtggtacagatgagagccaa
tcagagagagccaactgcagagttaccggctctccatctggttaccacgacaacccctca
gctcaggaggacaggaagacaggaagtcagaagctgagcgtcaatctgtgggaggagtta
cctgccatccccggtctgagtggccaattgcggagccgctttgcgatctacagctctgac
gaatcagaggacgaggagctgtgggaggagctactggagcttcgtcaaagacatctgctg
caggtgcagatgctgcaggtgactcagaagcgagagatggaggagctctattggatgaag
gggaaagtcccgccccctggaatcgtttctgcggccgccatgttgaaccaccgccatcgc
cgtccctccaagtcaggaaatgtccctccacctcgtaaagccagccagcagagagctgac
acgctgccccctgcaggcatcatgaggaggagctcagtgaacggcagcagtggtggatct
caggacagagctctgaaaggcgtgacgttcgcgtcgggacacagctgcatctga

DBGET integrated database retrieval system