KEGG   Kryptolebias marmoratus (mangrove rivulus): 108250862Help
Entry
108250862         CDS       T05608                                 

Definition
(RefSeq) glutamate receptor 1-like isoform X1
  KO
K05197  glutamate receptor 1
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108250862
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:kmr04040]
    108250862
Ion channels [BR:kmr04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   108250862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lig_chan ANF_receptor Lig_chan-Glu_bd SBP_bac_3 DUF2061
Motif
Other DBs
NCBI-GeneID: 108250862
NCBI-ProteinID: XP_017296429
Position
Unknown
AA seq 962 aa AA seqDB search
MGLLRLSAGGNMQLQSSPPLLLLLLLLLVMRTRIGRCSGTSFPSNINIGGLFPTGSHEYE
VFRFALAQHQDVPKLVPQVDMVDTGSSFAMTYAFCSQFSKGVYAIMGLYDRRTVNMLMSF
CSSLHVCFVTPSFPVQTNNQFVLQLRPQLQEPLMALLDHFYWTRFVYMYSSDSGLTVLQR
ILDTAAERSWQVTSVNLDTLTEPAFIKLLADLDYKKEFQIIIDCELERLNYILNLIAAQK
RNLKNYHYILANLGFLDLNVTELQKLAPNVTGFQLVNRSDPAVDKINQDWMDFDSKDLKL
ARKRLKYTGALTYDGVNVMAKAFQNLRRQRIDISRRGNAGECLANPPAPWGQGIDIQRAL
QQVRLEGLTGHVQFDERGHRTNYTLTVMELSHLGPRKIGFWNQKRGYVNTAVYKPLQEEF
FGLLNRTYIVTTILEAPYMMLKKNHDQFVGNERYEGYCAELASEIAKHVGFTYRLELVGD
GKYGARDPDTKMWNGMVGELVYGKADMAVAPLTITLVREQVIDFTKPFMSLGISIMIKKP
TKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWQSEDSDDEDETAPSSS
SRRAPPTSSSEDPHSPGFSQNQNQNQNQQKEKEAPEHTNDFGIFNSLWFSLGAFMQQGCD
ISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTL
DGGSTKEFFRRSKIAVFEKMWSYMRSAEPSVFVKSTNEGMIRVRKSKGKYAYLLESSMNE
YIEQRKPCDTMKVGGNLDSKGYGVATPKGSPLRNPVNLAVLKLNEQGLLDKLKNRWWYDK
GECGVGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALVEFCYKSRIESRRMKELID
AAMMSTSLGGVGGVAAGDLSGGAAGLGGENGRVMAYDFPKSGAQGLPCMSKAAGLGLSST
GM
NT seq 2889 nt NT seq  +upstreamnt  +downstreamnt
atgggattactccggctgtctgctggaggaaacatgcagctgcagagttctccgccgctg
ctgctgctgctgctgctgctgctggtgatgaggacgaggatcgggcgctgcagcggcaca
agtttcccaagtaacatcaacatcggaggccttttccccaccggttcccacgaatacgag
gtgtttcgtttcgccctcgcccagcatcaggacgtccccaagctggtgccgcaggtggac
atggtggacacggggagcagcttcgccatgacctacgccttttgctcccagttctcgaag
ggcgtgtacgccattatgggtctgtacgatcggcggacggtcaacatgctgatgtccttc
tgcagctcgctgcacgtgtgtttcgtcacgccgtccttcccggttcagaccaacaaccag
ttcgtcctccagctgcggccccagctgcaggagcccctcatggccctgctggaccacttc
tactggacccgcttcgtctacatgtacagctccgactcaggtctgacggtgctgcagagg
atcctggacacggcggcggagcgcagctggcaggtcacctccgttaacctggacactctg
acggagccggccttcatcaagctgctggccgacctcgactacaagaaggagtttcagatc
atcatcgactgtgagctggagcgcctcaactacatcctcaacctgattgctgctcagaag
agaaatctgaagaactaccattacatcctggccaatctgggattcctggacctgaacgtc
actgagcttcagaagctggcgccgaacgtgacaggcttccagctggtgaaccggtccgac
ccggccgtggacaaaattaaccaggactggatggactttgacagcaaagacctcaaactg
gcccgcaagaggctgaagtacacaggagctctaacgtacgacggcgtcaacgtcatggca
aaggccttccagaacctgcggcggcaacgcatcgacatctcacgccgtggcaacgcaggg
gagtgtctggccaacccgccggctccgtggggacagggcatcgacatacagagagccctg
cagcaggttcgtctcgagggcctgacgggtcacgtccagtttgatgagcgaggtcatcgc
accaactacaccctgactgtgatggagctcagccacctcggacccaggaagattggtttc
tggaatcagaagagaggctacgtgaacacggccgtctacaaaccgctgcaggaggagttc
tttggtctgctgaacagaacctacatcgtcaccactatcctggaagctccgtacatgatg
ctgaagaagaaccacgaccagtttgtggggaatgaaaggtacgaaggctactgcgccgaa
ctcgcctctgagatcgccaaacacgtcggcttcacctaccggctcgagctagtgggcgac
ggcaagtacggcgcccgggaccctgacacgaagatgtggaatgggatggtgggggagctg
gtgtacgggaaggccgacatggccgtcgcgccgctgaccatcacgttggtccgagagcag
gtgatcgacttcaccaaacccttcatgtctctgggcatctccatcatgatcaagaaaccc
accaagtccaaaccgggagtcttctccttcctggacccgctggcctacgagatctggatg
tgcatcgtcttcgcctacatcggagtcagcgtggtgctcttcctggtgagtcgctttagt
ccctacgagtggcagagcgaggactctgatgatgaagatgaaaccgctccgtcctcttca
tctcgacgagctccgcccacttcctcctctgaggacccccactctccaggcttctctcag
aaccagaaccagaaccagaaccagcagaaagaaaaggaggctcctgaacacaccaacgac
tttgggatcttcaactctctctggttctccctgggggccttcatgcagcaggggtgtgac
atctcccccaggtctctctctggtcgaatagtcggaggagtttggtggtttttcaccctc
atcatcatctcgtcctacacagccaacctggcagccttcctcactgtggaaaggatggtt
tcccccatagagagtgcagaggacctggccaagcagactgagatcgcctacgggacgctg
gacggcggctccaccaaagagttcttcaggcggtcaaagatcgccgtgtttgagaagatg
tggtcgtacatgcgcagcgccgagccgtccgtgttcgtgaagagcaccaacgaggggatg
atacgggtcaggaagtccaaggggaagtacgcctacctgctggagtcctccatgaacgag
tacatcgagcagaggaaaccctgcgacaccatgaaggtcggaggaaacctcgactccaaa
ggttacggagtggccacgcccaaagggtcgcccctcagaaaccctgtaaacttggcagtg
ttaaaactgaacgagcagggcctgttggacaaattgaaaaacagatggtggtatgacaag
ggagagtgcggcgtcgggggaggggactccaaggacaaaacgagcgcgctcagtctgagc
aacgtggccggcgtcttctacatcctgattggtgggctggggctggccatgctggtggcc
ctggtcgagttctgctacaagtcccgcatcgagtcccgcaggatgaaggagctcatcgac
gccgccatgatgagcaccagcctcggcggggtcgggggagtcgcggcgggcgatttgagc
ggaggagcggcgggactcggaggcgagaacggacgagtgatggcgtacgatttcccaaaa
tctggagctcagggtttgccctgcatgagcaaggcagcaggcctgggtctgtcctccaca
ggcatgtga

DBGET integrated database retrieval system