KEGG   Kryptolebias marmoratus (mangrove rivulus): 108250878
Entry
108250878         CDS       T05608                                 

Definition
(RefSeq) deoxycytidine kinase 1
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr00230  Purine metabolism
kmr00240  Pyrimidine metabolism
kmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    108250878
   00240 Pyrimidine metabolism
    108250878
Enzymes [BR:kmr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     108250878
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_28 Toxin_24 AAA_17
Other DBs
NCBI-GeneID: 108250878
NCBI-ProteinID: XP_017296448
UniProt: A0A3Q2ZVU0
AA seq 262 aa
MATPPKRPRGAPSSFSRRHKKISIEGNIAAGKSTFVRLLQAASEDWEVIPEPIGKWCNVQ
NDGDNIYQELSSSQKSGGNLLQMLYDKPSRWAYTFQSYACLSRIRAQLQSPSAKLQEAEN
PVQFYERSVYSDRYVFASNLFECDNLTETEWSVYQDWHTWLLKQFESDITLNGIIYLRAP
PQCCMQRLLHRGRDEEQGIPLEYLQQLHFKHESWLHHRNLRLDFDYLNELPVLVLDVEDD
FKNDLIKQEVIVDKVREFLTSL
NT seq 789 nt   +upstreamnt  +downstreamnt
atggcgaccccaccgaaaaggcctcgcggagctccgagcagcttttcccgccgacacaag
aagatctccatcgagggaaacatcgctgcaggtaaatccacctttgtgcgcctcctccag
gcggcctcagaggactgggaggtgattccagaaccaatcgggaagtggtgcaacgtccag
aacgacggcgacaatatttaccaggaactgagctcttctcaaaaaagtggaggaaacctg
ctgcagatgttgtatgataaacccagccgctgggcgtacacgttccagagctatgcgtgc
ctcagtagaatccgagctcagcttcagtctccatctgccaaacttcaggaggcagaaaac
ccggttcagttctacgagcgctccgtctactcagacaggtatgtgttcgcatctaatctg
tttgagtgcgataatctgacagaaaccgagtggagtgtttatcaggactggcacacctgg
ctactgaagcagtttgaatcagacataaccctcaatggcatcatctacctgagagctccg
ccgcagtgctgcatgcaaagattgctgcaccgaggtcgtgatgaggagcaggggattcct
ctggagtatctccagcaacttcacttcaaacacgagtcgtggctccaccacaggaacctc
aggctggactttgactacttgaatgaacttcctgttcttgttctggatgttgaagacgac
tttaagaacgatctcatcaaacaggaagtcatcgtagacaaggttcgagagtttctcacc
tcgttgtga

DBGET integrated database retrieval system