KEGG   Kryptolebias marmoratus (mangrove rivulus): 108251152Help
Entry
108251152         CDS       T05608                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    108251152
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:kmr04030]
    108251152
G protein-coupled receptors [BR:kmr04030]
 Rhodopsin family
  Lipid
   Leukotriene
    108251152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 108251152
NCBI-ProteinID: XP_017296836
UniProt: A0A3Q3FT57
Position
Unknown
AA seq 383 aa AA seqDB search
MNTTTFQQSSSPRSFSLPISVSARVGIAILTLAFVLGFPGNMFVVWSVLCRVKKRSVTCL
LVLNLAVADALVLLSAPLFLQYLARGRGWEFGSAACKLVHYLSSVNMYVSIYLICLMSMD
RWLAVTRPFMSQRMRTKRSLLVLLLGVWVLAFLLSLPMPFYRSNVKIMKNNFTLSICIPY
HWKSVGHRAFQYLFETIMGCLVPFSLISTCYSSVICRLQSAKFQRRAKGSRLILMIICAF
AIFWLPYNIVNIIEVIGLLQNSQSVIQAALTARPNVTAFAYFSSAVNPLLYVFAGSSHIR
QAGLSFMGRLFEATNSESRSTSTFTRSGRSSSSPDESSILQTLSVKLGKPFKGKSKERRS
SSMAGKEANEPELKTLATVEQLE
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccacaaccttccagcagtcctcctcccccagatccttctctctgcccatcagc
gtctcagcccgtgtcggtatcgccatcctgaccttagcatttgttctgggtttccctggg
aacatgtttgttgtctggtcggtcctctgcagggtgaagaagcgctcagtgacgtgtttg
ctggttttgaatctggctgtggctgatgctcttgtattgctcagtgcccctcttttcctg
cagtacctggcaagaggacggggatgggagtttggctcagcagcatgcaagctggtccat
tacctgtcaagtgtgaacatgtatgtgtccatctaccttatttgtctgatgagtatggac
cgctggctggctgtcacaaggccttttatgtctcagagaatgagaaccaagcgctctcta
ctggttcttctgctgggggtttgggtgttggcatttcttttgtctttgccaatgccattc
taccgcagcaatgtgaagataatgaaaaacaactttactctgagcatttgcatcccatac
cactggaaaagtgtgggtcaccgggccttccaatacctgtttgagacaatcatgggctgc
ctggtgccattctcactcatcagcacatgttactcctccgtcatatgcagactgcaaagt
gccaagttccagcgcagagcaaaaggcagtcgcctcatcctaatgatcatctgtgcattt
gccatattctggttgccatataacattgtcaacatcattgaggtgattggtcttttgcaa
aacagccaatcagtaattcaggctgctctcacagctcggcccaacgtcacagccttcgcg
tacttcagcagcgcagttaaccctcttctttacgtgtttgctggtagttcccacatccgc
caggctgggctgagcttcatgggcagactgttcgaggccactaactcagaaagtagaagc
acttccaccttcacccgcagcggccgcagcagctcctcaccggatgagagctcgatcctg
caaacgctgtccgttaaactcgggaagcctttcaaaggcaagagcaaagagaggaggagc
agcagcatggcaggcaaggaggccaatgaaccagagctaaagactcttgcaactgttgaa
cagttagaatag

DBGET integrated database retrieval system