KEGG   Kryptolebias marmoratus (mangrove rivulus): 108251206Help
Entry
108251206         CDS       T05608                                 

Gene name
utp18
Definition
(RefSeq) U3 small nucleolar RNA-associated protein 18 homolog isoform X1
  KO
K14553  U3 small nucleolar RNA-associated protein 18
Organism
kmr  Kryptolebias marmoratus (mangrove rivulus)
Pathway
kmr03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:kmr00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    108251206 (utp18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:kmr03009]
    108251206 (utp18)
Ribosome biogenesis [BR:kmr03009]
 Eukaryotic Type
  90S particles
   U3 small nucleolar RNA-associated proteins
    108251206 (utp18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 WD40_like Cytochrom_D1 Ge1_WD40 MMS1_N PQQ_3
Motif
Other DBs
NCBI-GeneID: 108251206
NCBI-ProteinID: XP_017296897
UniProt: A0A3Q3AQI8
Position
Unknown
AA seq 533 aa AA seqDB search
MADVIKLPGSEDKNRAKKRTRPAKSDPEKEEQLRQQNVKKLAVLGEEDGSVKRLESLVFG
AEDELLERLVEEEEDEQTGGLLLDDEELEQSEEEEEAPHHQELQTSKAAWVDEDDELEEE
VDMTHRYRRNLIKGEAEASMTKQKLQQRMREQFQKSMGGAPSWAEPSDQKKKKKKKKAAD
EEEDDDDEEEEDDLLRRTGNFVASSETLPGGVLRMKKCLPANSARPSEDRLSTVQFHPSA
QVVMTAGLDQSISLFQVDGKTNPKIQSIHLERFPVHKARFSRDGETVIATSLRNKMFYLY
DMMEGRVAPVHTVRGLNESRVKEFCVCPEGDALLLSGTNGYLHLLTLKTNEVVRSMKING
DVSGVAFSHDGSRVFVNSEDGEVYVWDVRSSRCVSRFSDDGCVKGTSIATSPNGRYLACG
SQSGVVNIYFQEACLNSTNPKPLKAVMNLLTSATSLTFNPSSEILAIASRVEDEAVRLVH
VPSLTVFSNFPVAKRKVAYRVSCLDFSPHSGFFSLANNKGNAPLFRLLHYKDF
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgtcatcaaactaccgggttccgaggacaagaaccgggccaagaaaagaacc
cgaccggcgaagtccgacccggagaaagaggagcagcttcggcagcagaacgtgaagaag
ctggcggttctgggagaggaggacgggtccgtgaagcggctggagtcgctggtgttcggg
gcggaggacgagctgctggagaggctcgtggaggaggaggaagatgagcagacaggaggc
ctgctgctggatgacgaagagttggagcagtctgaggaggaagaggaggctcctcatcat
caggagctgcagaccagcaaggctgcctgggtggacgaggacgatgagctggaggaagag
gtggacatgacgcatcgttaccgtaggaacctgatcaaaggagaagccgaggcgtccatg
accaaacagaagctccagcagaggatgagagagcagttccagaagtcgatgggaggggct
ccatcctgggcggagcctagtgaccagaagaagaagaagaagaagaagaaagcagctgat
gaagaggaagatgatgacgatgaagaggaggaagatgacctgctgagaaggacggggaac
tttgtggcgtcttcagaaacgctgcccggcggtgtcctgaggatgaagaagtgtcttcct
gccaacagcgcccgtccctcggaggaccggctgtccaccgtgcagttccacccctccgct
caggtggtcatgacggccggactggaccagtccatctccctgttccaggtcgacggaaag
acgaacccaaagattcagagcatccacctggagcggttcccggtccacaaggcccggttc
agccgggacggagagacggtgatcgccaccagcctgaggaacaagatgttctacctgtat
gacatgatggagggccgagtggcgccggtccacaccgtcagaggtctgaatgaaagcaga
gtgaaggagttctgcgtttgtcctgaaggggacgctctgctgctgagcggaaccaacggg
tacctgcacctcctcacgctgaagactaacgaggtcgttcgcagcatgaagatcaacggt
gacgtcagcggcgttgctttttctcatgacggcagcagagtttttgtaaactcagaggac
ggcgaggtatacgtgtgggacgtgcgcagcagccggtgcgtcagcaggttctcagatgac
ggctgcgtgaaggggacgtccatcgccacgtcaccaaatggacgttacctggcctgtggc
tctcagtcgggcgtggtcaacatctacttccaggaggcgtgtcttaactcgaccaatccg
aagcctctgaaggcggtgatgaacctgctgacttcggccacgtcgctgacttttaacccc
tcctcagagatcctcgccatcgcctcacgggtcgaagatgaggccgttcggctggtccac
gtgccgagcctcaccgtgttctccaacttccccgtcgctaagaggaaggtcgcttatcga
gtcagctgcctcgacttctcgccacacagcggcttcttctcattggctaacaacaaaggc
aacgcccccctcttcaggttgctgcactacaaagacttctga

DBGET integrated database retrieval system