KEGG   Kluyveromyces marxianus: KLMA_10518Help
Entry
KLMA_10518        CDS       T05269                                 

Gene name
INU1
Definition
(RefSeq) inulinase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00052  Galactose metabolism
kmx00500  Starch and sucrose metabolism
kmx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    KLMA_10518 (INU1)
   00500 Starch and sucrose metabolism
    KLMA_10518 (INU1)
Enzymes [BR:kmx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KLMA_10518 (INU1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 34714176
NCBI-ProteinID: XP_022674031
Position
1:complement(1092883..1094553)
Genome map
AA seq 556 aa AA seqDB search
MKLAYSLLLPLAGVSASVINYKRDGDSKAITNTTFSLNRPSVHFTPSHGWMNDPNGLWYD
AKEEDWHLYYQYNPAATIWGTPLYWGHAVSKDLTSWTDYGASLGPGSDDAGAFSGSMVID
YNNTSGFFNSSVDPRQRAVAVWTLSKGPSQAQHISYSLDGGYTFQHYSDNAVLDINSSNF
RDPKVFWHEGENGEDGRWIMAVAESQVFSVLFYSSPNLKNWTLESNFTHHGWTGTQYECP
GLVKVPYDSVADSSSNSSDSKPDSAWVLFVSINPGGPLGGSVTQYFVGDFNGTHFTPIDD
QTRFLDMGKDYYALQTFFNTPNEKDVYGIAWASNWQYAQQAPTDPWRSSMSLVRQFTLKD
FSTNPNSADVVLNSQPVLNYDALRKNGTTYSITNYTVTSENGKKIKLDNPSGSLEFHLEY
VFNGSPDIKSNVFADLSLYFKGNNDDNEYLRLGYETNGGAFFLDRGHTKIPFVKENLFFN
HQLAVTNPVSNYTTNVFDVYGVIDKNIIELYFDNGNVVSTNTFFFSTNNVIGEIDIKSPY
DKAYTINSFNVTQFNV
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaagttagcatactccctcttgcttccattggcaggagtcagtgcttcagttatcaat
tacaagagagatggtgacagcaaggccatcactaacaccactttcagtttgaacagacct
tctgtgcatttcactccatcccatggttggatgaacgatccaaatggtttgtggtacgat
gccaaggaagaagactggcatttgtactaccagtacaacccagcagccacgatctggggt
actccattgtactggggtcacgctgtttccaaggatttgacttcttggacagattacggt
gcttccttgggcccaggttccgacgacgctggtgcgttcagtggtagtatggttatcgat
tataacaatacttctggtttcttcaacagctctgtggacccaagacaaagagcagttgca
gtctggactttgtctaagggcccaagccaagcccagcacatcagttactcgttggacggt
ggttacaccttccaacactattccgacaacgccgtgttggacatcaacagctccaacttc
agagaccctaaggtgttctggcacgagggcgagaacggcgaagatggtcgttggatcatg
gccgttgctgaatcgcaagtgttctctgtgttgttctactcttctccaaacttgaaaaac
tggaccttggaatccaacttcacccaccacggctggactggtacccaatacgaatgccca
ggtctagttaaggttccatacgacagtgttgctgactcttcttcgaactcctccgactcc
aagccagactccgcatgggtcttgtttgtctccatcaaccctggtggtccattgggtggt
tccgttacccaatactttgttggtgacttcaacggtactcacttcactccaatcgacgat
caaaccagattcctagacatgggtaaggactactacgcactacaaactttcttcaacact
ccaaacgagaaggacgtctacggtatcgcatgggcttctaactggcaatacgcccaacaa
gccccaactgacccatggcgttcatctatgagtttggttagacaattcacattgaaagac
ttcagcacaaaccctaactccgccgatgtcgtcttgaacagtcaaccagtcttgaactat
gatgctttgagaaagaacggtaccacttacagcatcacaaactacaccgtcacctccgaa
aacggcaagaagatcaagctagacaacccatccggttctcttgaattccatcttgaatac
gtgtttaacggctccccagatatcaagagcaacgtgttcgctgatctttccttgtacttc
aagggtaacaacgacgacaacgaatacttgagattgggttacgaaaccaacggtggtgcc
ttcttcttggaccgtggccacaccaagattcctttcgtgaaggagaacttgttcttcaac
caccaattggcagttaccaacccagtttccaactacaccacaaacgtcttcgacgtttac
ggtgtcattgacaagaacatcatcgaattgtacttcgacaacggtaacgtcgtctccacc
aacactttcttcttctctaccaacaacgtcattggtgaaattgacatcaagtcaccatac
gacaaggcttacaccattaactcatttaacgttacccaatttaacgtttga

DBGET integrated database retrieval system