KEGG   Kluyveromyces marxianus: KLMA_20320Help
Entry
KLMA_20320        CDS       T05269                                 

Gene name
NOP58
Definition
(RefSeq) nucleolar protein 58
  KO
K14565  nucleolar protein 58
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    KLMA_20320 (NOP58)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:kmx03009]
    KLMA_20320 (NOP58)
Ribosome biogenesis [BR:kmx03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    KLMA_20320 (NOP58)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nop NOP5NT DUF4604
Motif
Other DBs
NCBI-GeneID: 34714795
NCBI-ProteinID: XP_022674650
Position
2:689440..690981
Genome map
AA seq 513 aa AA seqDB search
MAYVLTETSAGYALLKASDKKIYKSSTLIEDLNSSEKVLKQFKIAAFSKFSSAANALEEA
NSVIEGKVSSQLEKLLEECKTDKKATLVVSETKLANAINKLGLNFNVVSDAVTLDIYRAV
KEYLPELLPGMNDEDLSKMSLGLAHSIGRHKLKFSADKVDVMIIQAIALLDDLDKELNTY
AMRCKEWYGWHFPELAKIVTDSVAYARIILTMGIRVNAAETDMSEILPEEIEERVKTAAE
VSMGTEITPVDLENIKCLAEQIVEFAAYREQLSNYLSSRMKAIAPNLTQLVGELVGARLI
AHAGSLISLAKSPASTVQILGAEKALFRALKTKHDTPKYGLLYHASLVGQATGKNKGKIA
RVLAAKAAVSLRYDALAEDRDDSGDIGLECRAKVESRLSQLEGRDLRTTPKVVREHKKVE
ITEARAYNADADAVTTAAPSADSDDESEEEEETKEKSKKEKKEKKRKRDEDEDESKESKK
SKKEKKDKKEKKEKKDKKEKKDKKEKKEKKSKK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcttacgtcttgactgaaacctctgctgggtatgctcttttgaaagcttctgacaag
aagatttacaagtcttctactttgatcgaagacttgaacagcagtgagaaagtcttgaag
caatttaagattgctgctttctctaagttttcatctgctgctaatgctttggaagaagct
aactccgtcattgaaggtaaggtgtcatctcaactagagaagctgctagaagagtgcaag
acagacaagaaggctactctagttgtttctgaaaccaagttggctaacgctatcaacaag
ttgggcttgaacttcaacgttgtttctgatgctgttactttagatatctaccgtgccgtc
aaggaatatttgccagaattgttaccaggtatgaacgatgaggacctttccaagatgtcc
ttaggtttggctcattctattggtcgtcataagctaaagttctcagctgacaaggttgat
gttatgattatccaagctattgcattactagacgacctagataaggaattgaatacctat
gctatgagatgtaaggaatggtatggctggcatttcccagaattggccaagattgttact
gattctgttgcttacgccagaattatcttgaccatgggtatcagagttaacgctgctgaa
actgacatgtctgaaatcttgccagaagaaatcgaagaaagagttaagaccgcagctgaa
gtttctatgggtacagaaatcactccagtggatttggaaaacattaagtgtttggctgaa
caaattgttgaattcgctgcttacagagaacaactatccaactacttgtcatccagaatg
aaggctattgcaccaaatttgacccaattagttggtgaactagttggtgctagattaatt
gcccacgctggttctttgatctctttggctaagtctccagcttctactgttcaaattttg
ggtgccgaaaaagctttgttcagagctttgaagactaagcatgatacaccaaagtatggt
ctattgtaccatgcttccctagttggtcaagctactggtaagaacaagggtaagatcgca
agagttttggctgctaaggctgctgtttctttgcgttacgatgctttggcagaagacaga
gatgactctggtgacatcggtttggaatgcagagcaaaggttgaatccagattatcacaa
cttgaaggtagagacttgagaactactccaaaggttgttcgtgaacacaagaaggttgaa
atcacagaagctagagcttataacgctgatgctgatgccgtgacaaccgctgctccatct
gctgattcagacgacgaatctgaagaggaagaagaaactaaggaaaagtctaagaaggaa
aagaaggaaaagaagaggaagagagatgaagatgaagatgaatccaaggagtctaagaag
tctaagaaggaaaagaaggacaagaaggaaaagaaggaaaagaaggacaagaaggaaaag
aaagacaagaaggaaaagaaggaaaagaagtctaagaaatag

DBGET integrated database retrieval system