KEGG   Kluyveromyces marxianus: KLMA_20568Help
Entry
KLMA_20568        CDS       T05269                                 

Gene name
LSC1
Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit alpha
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00020  Citrate cycle (TCA cycle)
kmx00640  Propanoate metabolism
kmx01100  Metabolic pathways
kmx01110  Biosynthesis of secondary metabolites
kmx01130  Biosynthesis of antibiotics
kmx01200  Carbon metabolism
Module
kmx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kmx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLMA_20568 (LSC1)
   00640 Propanoate metabolism
    KLMA_20568 (LSC1)
Enzymes [BR:kmx01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     KLMA_20568 (LSC1)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     KLMA_20568 (LSC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 34715035
NCBI-ProteinID: XP_022674890
Position
2:complement(1175765..1176721)
Genome map
AA seq 318 aa AA seqDB search
MLRTIGRRFFSREATPYDSTIKNLLLSKDTKVIFQGFTGKQATFHAKISQEYGTNVVGGT
NPKKAGQTHLGQPVFASVAEAVKQTGATASGIFVPPPIAAPAIREAIEAEIPLAVAITEG
IPQHDMLYIAEMLKSQDKTRLVGPNCPGIISPTARVRIGIQPTSIFKPGKIGIVSKSGTL
TYEAVQQTTITDLGQSLVIGIGGDAFPGTDFIDALTLFMNDPQTEGIILLGEIGGTAEIE
AAEYLKAYNLTREKPLPVASFIAGTVAGQMKGVRMGHSGAIVEGSGTDAESKKKALRAAN
VAVVESPGHLGKALLEQF
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgttacgcacaatcggtcgccgtttcttctccagagaagctaccccatacgacagcacc
atcaagaacttgctattgtccaaggacaccaaggtcattttccagggtttcaccggtaaa
caagccactttccacgccaagatatcgcaggaatacggcaccaacgtcgttggtggtacc
aacccaaagaaggcaggccaaactcatttgggacaaccggttttcgccagcgtcgctgaa
gctgtcaagcaaaccggcgctaccgcctcaggtatctttgtgcctccaccaatcgctgcc
ccagccatcagagaagccatcgaagccgaaattccactagccgtcgctatcaccgaaggt
atccctcaacacgacatgctatacatcgctgaaatgttgaagtcccaggacaagacccgt
ttggtcggtccaaactgtccaggtatcatctccccaaccgcaagagtcagaatcggtatc
cagccaaccagtatcttcaagccaggtaaaatcggtatcgtctcaaagtccggtaccttg
acctacgaagccgtccaacaaactaccatcaccgacttgggtcaatccttggtcatcggt
atcggtggtgatgccttcccaggtactgacttcatcgacgccctaactttgttcatgaac
gacccacaaacagagggtatcattttgttgggtgaaatcggtggtaccgctgaaatagag
gccgctgaatacttgaaggcctacaacttgaccagagaaaagcctttgcctgtcgcctcc
ttcatcgctggtaccgtcgccggccaaatgaagggtgtcagaatgggtcactccggtgcc
atcgtcgaaggttccggtaccgacgccgaatccaagaagaaggctttgagagccgctaac
gtcgccgtcgtcgaatccccaggtcacttgggtaaggctctattggaacaattctga

DBGET integrated database retrieval system