KEGG   Kluyveromyces marxianus: KLMA_30370Help
Entry
KLMA_30370        CDS       T05269                                 

Gene name
GSY2
Definition
(RefSeq) glycogen [starch] synthase isoform 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00500  Starch and sucrose metabolism
kmx01100  Metabolic pathways
Module
kmx_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KLMA_30370 (GSY2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:kmx01003]
    KLMA_30370 (GSY2)
Enzymes [BR:kmx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     KLMA_30370 (GSY2)
Glycosyltransferases [BR:kmx01003]
 Polysaccharide
  Storage polysaccharide
   KLMA_30370 (GSY2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_4_4 Glyco_transf_5
Motif
Other DBs
NCBI-GeneID: 34715646
NCBI-ProteinID: XP_022675501
Position
3:826604..828709
Genome map
AA seq 701 aa AA seqDB search
MTRDIANHLLFEVATEVANKVGGIYSVLKSKAPITCKQYGPKYMLLGPLNPQSMQVEVEP
VDWEKEENFYIKEVQWALRSMYNRGVRFTYGRWLIDGAPMVILFDINSVRGYMNEWKADL
WEIAGIPSPDGDFETNDAILLGYTVAWFLGELAHMNQTNAIVAHFHEWLAGVAVPLCRKR
RIDVVTIFTTHATLLGRYLCAGNVDFYNNLDKFDVDAEAGKRGIYHRYCIERAAAHSSDV
FTTVSQITAYESEHLLKRKPDGILPNGLNVIKFQAVHEFQNLHALKKEKINDFIRGHFHG
NFDFDLDKTLYFFIAGRYEYRNKGADMFIEALARLNHRLKASGSKMTVVAFIIMPAKNKS
YTVDELRGQAVVSQLENSVKDVTQLIGKRIFEHAMRFPHNGTKTEIPTSLEELLKPSDKV
LLKKRVFALRRPEGTLPPIVTHNMVDDATDPVLNQIRRVQLFNNSYDRVKIIFHPEFLNA
NNPILSLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSITTNLSGFGAYMEDLIEK
DQAKDYGIYIVDRRFKNPDESVNQLVDYMEEFVLKTRRQRINQRNRTERLSDLLDWRRMG
LEYVKARQLALRRAYPDEFKELTGGNELDDSNMDSMAGKKQKIKVARPLSVPGSPKDSRA
SSVGAVMMTPGDFGTLQDANNADDYFHLAMDDDEEDDEEDY
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atgactcgtgacattgcgaaccatttgttgttcgaagtggcgactgaggtcgccaataag
gttggtggtatttactcggttttgaagtcgaaggcgcctatcacgtgcaagcagtatggc
cctaagtacatgcttttgggtccgttgaacccgcaatcgatgcaggtggaggtggagccc
gtggactgggagaaagaggagaacttctacatcaaggaggtgcaatgggcgttgcgttcg
atgtacaaccgtggggtgcgtttcacgtacgggcgctggcttatcgacggagcgcccatg
gtgattttgttcgatatcaactccgtgcgcggttacatgaacgagtggaaggcggatctg
tgggagatcgcgggcattccgtcaccggacggagacttcgagaccaacgacgccatcttg
ttgggctacacggtggcgtggttcctaggcgaattggcccacatgaaccagaccaacgcc
atcgtggcgcatttccacgagtggttggccggtgtggccgtcccgttgtgcagaaaacgt
cgcatcgacgtcgtcaccatctttaccacacacgcaactttgctaggaagatacttgtgt
gccggtaacgtcgatttctacaacaacttggacaagttcgacgtggacgccgaagcgggc
aaacgtgggatctaccaccgttactgcatcgagcgcgccgccgcccacagctcagacgtg
ttcaccacagtctcacagatcacagcgtatgaaagtgaacatcttttgaaacgtaaacca
gacggcatcttgcccaacggtttgaacgtcatcaagttccaagcagttcacgaattccaa
aacttgcatgcattgaaaaaggaaaagatcaatgacttcatcagaggccatttccacggc
aacttcgacttcgaccttgacaagactctatacttctttatcgctggccggtatgagtac
cgtaataagggtgccgatatgttcatagaagcgttggctagattgaaccacagattaaag
gcttccgggtccaaaatgacagtcgttgcattcatcatcatgccagcaaaaaataagtcc
tacaccgtcgacgaactaagaggacaagctgtcgtgagccagttggaaaactccgtcaag
gatgttacccaactcatcggtaagagaatcttcgaacacgccatgagattccctcataac
ggcacaaagacagaaatcccaacttcccttgaagaattgttgaaaccaagcgacaaggtc
ctattgaagaaacgtgtgtttgcattgcgtaggccagagggaaccctacccccaatcgtg
acccacaacatggtggacgacgctacggatcccgtcttgaaccaaatcagacgtgtccaa
ttgttcaacaactcgtacgatcgtgtcaagatcattttccatccagagttcttgaacgcc
aataacccaatcttatctctagattacgacgagttcgtcagaggttgccatttgggtgtg
ttcccttcgtattacgagccatggggttacaccccagcagagtgtaccgtcatgggtatc
ccatccatcacaaccaacttgtccggttttggtgcatacatggaggatttgatagagaag
gatcaggctaaggattacggtatctacatcgtagaccgtcgtttcaaaaacccagacgag
tctgtcaaccagcttgtcgactacatggaggagttcgtcctcaagacccgtagacaaaga
atcaaccaaagaaacagaactgaacgtttatccgatctattggactggagacgtatgggt
ttagaatacgtcaaggctcgtcaacttgccttgcgtagagcgtacccagatgagttcaaa
gaattgacaggcggaaacgaactcgatgactccaacatggattcaatggcaggtaaaaaa
caaaaaatcaaggtcgcaagacctttgagtgtccctggctctccaaaggactctagagca
agcagcgttggcgccgtaatgatgactcccggcgatttcgggactctacaagacgctaac
aacgcagatgactatttccatcttgccatggatgacgacgaagaggacgatgaagaagat
tattag

DBGET integrated database retrieval system