KEGG   Kluyveromyces marxianus: KLMA_30719Help
Entry
KLMA_30719        CDS       T05269                                 

Gene name
PCK1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase [ATP]
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00010  Glycolysis / Gluconeogenesis
kmx00020  Citrate cycle (TCA cycle)
kmx00620  Pyruvate metabolism
kmx01100  Metabolic pathways
kmx01110  Biosynthesis of secondary metabolites
kmx01130  Biosynthesis of antibiotics
kmx01200  Carbon metabolism
Module
kmx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLMA_30719 (PCK1)
   00020 Citrate cycle (TCA cycle)
    KLMA_30719 (PCK1)
   00620 Pyruvate metabolism
    KLMA_30719 (PCK1)
Enzymes [BR:kmx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     KLMA_30719 (PCK1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 ATPase AAA_29
Motif
Other DBs
NCBI-GeneID: 34715987
NCBI-ProteinID: XP_022675844
Position
3:1558908..1560539
Genome map
AA seq 543 aa AA seqDB search
MSPSKIHHSAEQNIRSELGLSEEVVTIRRNAPAALLYEDALKERATAISSAGALIAYSGD
KTGRSPRDKRIVEEETSKDNIWWGPVNKPCSERTWEINRERAADYLRTRDHIYIVDAYAG
WDPRYRIKVRVVCARAYHALFMTNMLIRPTQEELENFGEPDFTIWNAGQFPANTHTSGMT
SKTTIEINFKQMEMVILGTEYAGEMKKGIFTVMFYLMPVNHNVLTLHSSANQGITEKDVT
LFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCLGLSGEKEPEIFNAI
RFGSVLENVIYDPNTREVDYDDSSITENTRCAYPIDYIPSAKIPCIAESHPKNIVLLTCD
ASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEEGVTEPEATFSSCFGQPFLALHPMKYAT
MLAEKMAEHNANAWLINTGWTGSSYVSGGKRCPLKYTRAILDAIHDGSLANEEYETLPIF
NLQVPKAVGDKVPPSLLNPSRNWVEGEAKYLSKVKTLAGLFVENFKTYQDKATSQVLAAG
PQL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtccccaagcaaaattcaccactcggccgaacaaaatatcagaagtgaattaggcctt
tctgaggaagttgttacaattagacgtaatgctccagctgctttattgtatgaagatgct
ttgaaggaaagagccactgcaatttccagtgctggcgctttgattgcttactccggtgac
aaaactggtagatcaccacgtgataagcgtatcgttgaagaagagacttccaaagataac
atttggtggggtccagtaaataaaccatgttctgagagaacttgggaaatcaacagagaa
cgagccgctgactacttgagaacaagagatcatatttacattgttgatgcttacgctggt
tgggaccctcgttacagaattaaggtcagagtcgtttgtgctagagcttaccatgcattg
ttcatgaccaatatgttgattagaccaacgcaagaagagctagaaaactttggagaacct
gacttcacaatttggaatgctggccaattccctgctaacacacacacctccggtatgaca
tctaagactaccattgaaatcaacttcaagcaaatggaaatggttattttgggtaccgaa
tatgctggtgaaatgaagaaaggtatcttcaccgttatgttctatttgatgcctgtcaac
cataacgtacttaccttacattccagtgctaaccaaggtatcactgagaaagatgttact
ttgttcttcggtttgagtggtactggtaagactaccttgtctgctgacccacatagactg
ttgatcggtgatgatgaacactgctggtccgatcatggtgtcttcaacatcgaaggtggt
tgctacgccaaatgtctgggtttgtcaggagaaaaggaacctgagatctttaacgccatt
aggtttggttctgttttggaaaatgtcatctacgacccaaacaccagagaagttgattat
gatgactcctcaattaccgaaaacacaagatgtgcttacccaattgattatattccaagc
gctaagatcccatgtatagctgaaagtcatccaaagaacattgttcttttgacatgtgat
gcatctggtgttctaccaccagtgtctaagttgacaccagagcaagtcatgtaccacttt
atctctggttatacttctaagatggcgggaaccgaagaaggtgtcactgagccagaagca
accttctcgtcttgtttcggtcaaccattcttggcattacacccaatgaagtacgctacc
atgttggctgagaaaatggccgaacataatgcaaatgcttggttgatcaacactggttgg
actggttcttcttatgtttctggtggtaaacgttgtccgctaaaatacacaagagccatc
ttggatgcaattcacgatggatctttggctaatgaagaatacgagactctacctatcttc
aacttgcaagttccaaaggctgttggcgataaggttcctccttctctactaaacccaagc
agaaactgggttgaaggtgaagccaagtatttgtcaaaggttaagacattggccggtttg
ttcgtagagaactttaagacttaccaggataaggctacctcccaggttttggctgctggt
cctcaactatga

DBGET integrated database retrieval system