KEGG   Kluyveromyces marxianus: KLMA_40242Help
Entry
KLMA_40242        CDS       T05269                                 

Gene name
MSN5
Definition
(RefSeq) protein MSN5
  KO
K14289  exportin-5
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx03013  RNA transport
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    KLMA_40242 (MSN5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kmx03016]
    KLMA_40242 (MSN5)
   03036 Chromosome and associated proteins [BR:kmx03036]
    KLMA_40242 (MSN5)
Transfer RNA biogenesis [BR:kmx03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    KLMA_40242 (MSN5)
Chromosome and associated proteins [BR:kmx03036]
 Eukaryotic type
  Gene silencing
   microRNA pathway
    Other miRNA pathway proteins
     KLMA_40242 (MSN5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Xpo1 IBN_N
Motif
Other DBs
NCBI-GeneID: 34716230
NCBI-ProteinID: XP_022676089
Position
4:complement(564367..568032)
Genome map
AA seq 1221 aa AA seqDB search
MDGLGASQVVTALEVIYDPKTENVKRVEAQKFLDEVKDREESPFWGYEIALNNPQNSILK
HFGLGLLVNALKRNWSGYDEEKRLTLRKWIVELNYRVQPNDPRYIKEKLAFLWVEVAKRV
WGEALKIEEPSQQQLEESWVDMDRCLTELWQMSEESRELALIIFRTLFEDTFLLEDVAIL
KRLPIIQPLCIMIVCPMEMFSAKYKYSGKWELFKSNPKGWFALFSEELNAALDVNNAQYI
VRLLETLKSCLNWPLSDVIISNDIFSALLRCLTKDIPKAQSIALDSIHILLTRPYSNTDH
YNLIVNRVFDSMTLMDTIYSQLQFDPTEGVDEAKYPIMKKFVDMITCLYTCVLKISDLQN
IEAYMKLVLKTTYNPSLIVSGLSLDLWCACLRNDDFLPILDKLVIPDLLEFAGNALIYYE
QIDDHVSKNFVEVDFQSTSEYENYCSSYRKRLRDIIRLISCVQLDFAYDWLCERLNKYFS
SQYGQQVLSATYLDHKSEPYLSALTQFMIVECFINGCIRWKIWYTDEATFNQKLDVILGK
VETLSNQLLALNLREPLLLKKQIQNFALFLTILKDNVLFTLLEKIITTATLEYPEIDMNE
KNQQSDAVRDLRYACGIELNRMALLMPASLEPIYPDLENVVAGILPKLSSHETISFKSFL
LTIVLKSGLPNKEEKFAQLVDPELAAWSDKGTVVGLTDLPWFLERLGIVKIAEYFQKRNI
DENSDLLSIQMDEDGKKLKADLTQHWQTIFPVRATRMFIHYSMQSVKGNDEFRMLQELWK
PRIVPFLPYILRLLYQLQSYHNPANWTSLPTVVQSFVRVSTVERFWEAGATNKSKDEFID
EHNKALQTVRDFADSVGHIVRYTREYVLLVLASMSGLGTIFFEVNDLANLIMDSIAIYTP
DGEISPGVSTHGWKHIINVAVRPMLRNCPDECAPQFMSVFLPKLFKTLDLLLEKRWSAYS
QSEVNPPPRDEDEMTEEILEENLLRQFTTVVVRLLIDSVGQVGSHAQASKMRVSVHQMKM
RKIIFEDINILAPFLRLLNRLVSVRDSKCSFNSILILKSCLAETLAKDPEVDRFYTTEVV
PNLILNVLTQRAFKDSFYEALYAFTVIFLTLSKEFDYFNQYLYDLSRGYNIEELYNTLKQ
VDNYKDQRVVAAEFIDWMKNIYGDQDDNHFSADQEAKIKQRREAVIARASEQLLGKNKPE
SNMFEDPNIEGDVLGGLFENN
NT seq 3666 nt NT seq  +upstreamnt  +downstreamnt
atggacggtctaggggcatctcaggtagtgaccgctttagaagtaatttatgatccaaaa
acggagaatgtaaaaagagtggaagcacaaaaatttctggatgaggttaaagaccgagag
gagtctcctttctggggttatgaaatcgcgttaaacaatccacagaattcaattctaaaa
cacttcggtttgggattattggtgaacgcattgaagaggaattggagcggttatgatgag
gagaaaaggctgaccttgaggaaatggattgtggaactcaattacagagtgcagccaaat
gatccaaggtatatcaaagagaaacttgctttcttatgggtggaagtcgccaaaagggtt
tggggtgaagctttgaaaatagaggaaccatctcaacaacaattggaggaatcttgggta
gatatggatagatgtttgactgaattgtggcaaatgagtgaagaatcgagagaactagcg
ttgattatttttaggaccctttttgaagacacattcttgttagaggatgtcgcgattttg
aagcgtttaccaatcatacagcctctttgtattatgatagtgtgtcctatggagatgttt
agtgcgaagtataagtattcggggaagtgggaacttttcaaatctaaccctaagggttgg
tttgcgcttttcagtgaggagttgaatgcagcattggatgttaacaacgctcaatatatc
gtgagattattagagacattgaaaagttgtctaaattggccactcagtgatgttataata
tccaacgatatattctctgcactattgagatgtctcacaaaggatatcccaaaggcacaa
tcgattgctttggactctattcatattcttctaacacgtccttatagtaacacagatcac
tacaatttgattgtaaatcgtgtttttgacagtatgaccttgatggatactatatattca
cagctccaatttgatcctacagaaggagttgatgaagcaaaataccctataatgaagaaa
tttgttgatatgattacttgtttatacacatgtgttctcaaaatatcagatctgcagaac
attgaggcatatatgaaattggttttaaaaactacctataaccctagtctaatagtcagt
gggctatcattggacctttggtgtgcatgtttaagaaatgatgacttcttgccgatttta
gataaactggttattcctgacttattagaatttgcagggaatgcattgatatattatgaa
cagattgatgatcacgtctctaagaactttgtggaggtagacttccaatctacatcagag
tatgaaaactactgttccagttatagaaaaaggctcagagatataatccgtctaatatca
tgtgttcagttagattttgcttacgattggttatgtgaaagactcaataaatacttcagc
tcgcaatatggacaacaagtattaagcgctacatatttggatcataaatcagagccatat
ttgagtgctctgactcagtttatgattgtggaatgtttcatcaatggttgtatacgatgg
aaaatatggtacaccgatgaagccactttcaaccaaaagcttgatgtgattcttgggaaa
gtagaaactctatccaatcagcttttagcattgaatttgagagagcctttgctccttaag
aaacaaattcagaactttgcattatttttaactattttgaaagacaatgtcctcttcact
ttacttgaaaaaatcattacaactgctaccttagaataccctgaaatcgatatgaacgaa
aagaatcagcagtctgatgcagttcgtgatttaaggtatgcctgtggtattgaacttaat
cgtatggcattattaatgcctgcctctttagaaccaatatatcctgatctagagaatgtt
gttgcaggtatattaccaaaactaagttcccatgaaactatttcattcaagtcattttta
ttaacaattgttctaaagtctggattgccaaacaaagaagaaaagtttgcacagttggtt
gatccagaattggctgcttggtcggacaaaggaacagttgtcggcctaacggacctccct
tggttccttgagaggttgggtatagtaaaaattgcagaatatttccagaaacggaatatt
gatgagaatagtgacttattatccattcaaatggacgaagatgggaaaaaactaaaagca
gatttgacgcaacattggcagactatctttccggtccgtgcaacccggatgtttatccat
tattccatgcaaagcgtcaaaggcaatgatgaatttagaatgttacaagaactatggaaa
cctcggatagtaccgtttttaccatacatcctaagacttctttatcaacttcagtcttat
cacaacccagccaactggacttctcttccaactgttgtacagtctttcgtacgcgtttct
actgttgagagattctgggaggctggtgcaaccaataaatctaaagatgaatttattgat
gagcacaacaaagctttgcaaacggtacgtgactttgcggactctgttggccatattgta
agatatactagagaatacgttcttttagttcttgcttcgatgtcaggtctcggaacaatt
ttcttcgaagtgaacgaccttgcaaacctaataatggactccattgccatttacacccca
gatggtgagattagtcccggtgtatcaacacatggctggaaacacataataaatgttgct
gttagaccaatgctaagaaattgtcctgatgaatgtgccccacagtttatgtcagtgttc
ttacccaagttgttcaagacattggatttattgttggagaaaaggtggtctgcgtatagt
caaagtgaggtaaatccacctcctagagatgaagatgaaatgacagaagagatccttgag
gagaatttattgcgtcagttcactactgttgttgtaaggttactaatagattccgtcgga
caggtgggatcacatgcacaggcctctaagatgagagtatcagtacatcaaatgaagatg
aggaagattatctttgaagatatcaacattctagcgccattcttgaggttgttaaatagg
cttgtctcagtgagagacagcaaatgctctttcaactcaattctaatattaaagagttgt
ttagcagaaacattggcgaaggatccggaagttgacagattttataccactgaagtcgtt
ccaaatctaattttaaatgttctaactcagagggccttcaaagactctttctatgaggcg
ctttatgcgttcacggtcatattcttaaccctttcaaaagagttcgattactttaaccaa
tacctttacgatttatctagaggatacaatattgaagagctttacaacactttgaagcaa
gtagataactacaaagaccagagagtagtagcggccgaatttatagactggatgaagaac
atatatggcgatcaagatgataatcatttctctgcagatcaagaggcaaagatcaaacaa
aggcgagaggctgttatagcaagagcaagtgaacaacttctcgggaaaaacaagccggaa
tctaacatgtttgaggaccctaatattgaaggtgatgtcttaggtgggttgtttgaaaac
aactag

DBGET integrated database retrieval system