KEGG   Kluyveromyces marxianus: KLMA_50016Help
Entry
KLMA_50016        CDS       T05269                                 

Gene name
BDH1
Definition
(RefSeq) (2R,3R)-2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KLMA_50016 (BDH1)
Enzymes [BR:kmx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     KLMA_50016 (BDH1)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     KLMA_50016 (BDH1)
    1.1.1.-  
     KLMA_50016 (BDH1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 34716633
NCBI-ProteinID: XP_022676490
Position
5:complement(31447..32802)
Genome map
AA seq 451 aa AA seqDB search
MELKAWGGGGGIGVMPSIVYKKMYVGNVTKQGTWFLEEYPYVLELVRTQLHFCVYISIEC
SSNNLVIMRALAYFGKKDIKFTNDLKEPTIGVDDEVEINVAWCGICGSDLHEYLDGPIFF
PEDGKTHDVSGLGLPQAMGHEMSGIVSKVGSKVKNVKPGDRVVVEATGSCLDHYRWEGSA
HAKDGNCAACSRGYYNCCAHLGFMGLGVHSGGFAEKVVISERHIVKIPDSLPLDVAALVE
PISVSWHAVRISHLQEGQSALVLGAGPIGLATILALQGHGASKIVVSEPAEIRRRQAAKL
GVETFNPMEHGDDAVEILKKMAPGGEGFDFAYDCSGVKATFDTGVHAVTFRGMYVNIAIW
GHKPIDFRPMDVTLQEKFITGSMCYTVEDFKAVVAAFADGRIEVDKARHLITGKQKIEDG
FEKGFDELMNHKEKNIKILLTPNNHGELNAN
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggaactaaaagcgtggggggggggggggggaataggagtcatgccgagtattgtatat
aagaagatgtatgtaggaaacgttacaaaacaaggtacttggtttctcgaagagtaccct
tatgtcttggaattagttcgtacacagcttcacttttgtgtatatatttccatagagtgt
agtagtaataaccttgtaataatgcgtgcgttagcgtatttcggtaagaaagatattaaa
tttacaaatgatttaaaggagcctaccatcggggtggacgatgaagtagaaattaacgtt
gcttggtgtggtatttgtggtagtgaccttcacgaatacctagatggtccaattttcttc
cccgaagatgggaagacccatgatgtcagtggtcttggtttacctcaggctatggggcat
gaaatgtccggtatagtgtcaaaggttggatctaaagtgaaaaacgtcaagcctggtgac
cgtgttgttgtcgaagctactgggtcatgtttagatcattaccgttgggagggttctgct
catgcaaaagatgggaattgcgctgcttgtagtagaggatattacaactgttgtgcccat
ttagggttcatgggtcttggtgtgcacagcggtggtttcgcagagaaagttgttataagt
gaaagacatatagttaagattccagactctttacctttagacgttgcagcattggtggaa
ccaatttcagtgtcttggcatgcagtcagaatatcgcacttacaagaaggccaatctgcg
ctcgtgctaggtgcgggtcctattggtttggctacaatcttggcgttacaaggtcatggt
gcttctaaaatcgtcgtttcagaaccagctgaaattaggagacgccaggcagcaaaatta
ggtgttgaaactttcaatccaatggaacacggtgatgatgctgtagaaattttgaagaaa
atggcgccaggaggtgaagggtttgactttgcctacgattgctcaggtgtcaaagcaact
ttcgacaccggtgttcatgcagtgacattcagaggtatgtatgttaacattgcaatttgg
ggtcacaaaccaatcgatttccgaccaatggatgtcactttacaagaaaagttcattact
ggttccatgtgttacactgtagaagattttaaagctgtcgtcgcagcttttgctgatgga
agaatcgaagtagataaggcaagacatttgattaccggtaagcaaaaaatcgaggatggt
ttcgaaaagggtttcgatgaattaatgaatcacaaggaaaagaatattaagatcctacta
acaccaaataatcacggtgaactgaatgctaattaa

DBGET integrated database retrieval system