KEGG   Kluyveromyces marxianus: KLMA_50592Help
Entry
KLMA_50592        CDS       T05269                                 

Gene name
SSB
Definition
(RefSeq) heat shock protein SSB
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx03040  Spliceosome
kmx04141  Protein processing in endoplasmic reticulum
kmx04144  Endocytosis
kmx04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    KLMA_50592 (SSB)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    KLMA_50592 (SSB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    KLMA_50592 (SSB)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    KLMA_50592 (SSB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:kmx01009]
    KLMA_50592 (SSB)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:kmx03041]
    KLMA_50592 (SSB)
   03009 Ribosome biogenesis [BR:kmx03009]
    KLMA_50592 (SSB)
   03110 Chaperones and folding catalysts [BR:kmx03110]
    KLMA_50592 (SSB)
   04131 Membrane trafficking [BR:kmx04131]
    KLMA_50592 (SSB)
   03051 Proteasome [BR:kmx03051]
    KLMA_50592 (SSB)
   03029 Mitochondrial biogenesis [BR:kmx03029]
    KLMA_50592 (SSB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kmx04147]
    KLMA_50592 (SSB)
Protein phosphatases and associated proteins [BR:kmx01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     KLMA_50592 (SSB)
Spliceosome [BR:kmx03041]
 Complex B
  Other components
   Prp19 complex
    KLMA_50592 (SSB)
 Complex C
   Prp19-CDC5 complex
    KLMA_50592 (SSB)
Ribosome biogenesis [BR:kmx03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    KLMA_50592 (SSB)
Chaperones and folding catalysts [BR:kmx03110]
 Heat shock proteins
  HSP70 / DNAK
   KLMA_50592 (SSB)
Membrane trafficking [BR:kmx04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    KLMA_50592 (SSB)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    KLMA_50592 (SSB)
Proteasome [BR:kmx03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    KLMA_50592 (SSB)
Mitochondrial biogenesis [BR:kmx03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    KLMA_50592 (SSB)
Exosome [BR:kmx04147]
 Exosomal proteins
  Proteins found in most exosomes
   KLMA_50592 (SSB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Paralemmin
Motif
Other DBs
NCBI-GeneID: 34717184
NCBI-ProteinID: XP_022677042
Position
5:complement(1255517..1257358)
Genome map
AA seq 613 aa AA seqDB search
MAEGVFPGAIGIDLGTTYSCVATYENSVEIIANEQGNRVTPSFVAFTPEERLIGDAAKNQ
AALNPKNTVFDAKRLIGRRFDEESVQSDMKTWPFKVIDSNGAPLIEVEYLGETKTFSPQE
ISSMVLTKMKEIAEAKIGKKVEKAVVTVPAYFNDAQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLGAGKSEKERHVLIFDLGGGTFDVSLLHIAGGVYTVKSTSGNTHLGGQDFDTNL
LEHFKTEFKKKTGADISGDARALRRLRTAAERAKRTLSSVAQTTVEVDSLFDGEDFEATI
TRARFEDINAALFKSTLEPVEQVLKDAKISKSQIDEVVLVGGSTRIPKVQKLLSDFFDGK
QLEKSINPDEAVAYGAAVQGAILTGQSTSDETKDLLLLDVAPLSLGVGMAGDVFGVVVPR
NTTVPTIKRRTFTTVADHQTTVTFPVYQGERVNCKENTLLGEFDLKGVPPMPAGEPVLEA
IFEVDANGILKVTAVEKSTGKSANITISNAIGRLSSEEIEQMVNQAEEFKAADEAFAKKH
EARQRLESYISSVEQTVTDPVLSAKIKRNAKAKVEAALADAFSTLQIEDASADDLRKAEV
GLKRAVTKAMSTR
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaggtgttttcccaggtgctatcggtatcgatttaggtacaacttactcttgt
gttgctacttacgagaattccgttgaaattattgccaacgaacaaggtaacagagttact
ccttctttcgtcgctttcactccagaagaaagattgattggtgatgctgctaagaaccaa
gctgctttgaacccaaagaacaccgtcttcgacgctaagcgtttgatcggtagaagattc
gatgaagaatctgttcaatctgacatgaagacctggccattcaaggttatcgactccaac
ggtgccccattgattgaagttgaatacctaggtgaaaccaagactttctctccacaagaa
atctcttccatggtcttgaccaagatgaaggaaattgctgaggccaagattggtaagaag
gttgaaaaggctgtcgttaccgtcccagcatacttcaacgatgctcaaagacaagctacc
aaggatgctggtgccattgctggtttgaacgttttgagaattatcaacgaacctaccgct
gctgccatcgcttacggtctaggtgctggtaagtccgaaaaggaaagacacgtcttgatc
ttcgatttgggtggtggtactttcgatgtttctttgctacacatcgctggtggtgtttac
actgttaagtctacttctggtaacactcacttgggtggtcaagatttcgacaccaacttg
ttggaacacttcaagactgaattcaagaagaagactggtgctgacatctccggtgacgct
agagctttgagaagactaagaactgctgctgaaagagctaagagaactttgtcctctgtt
gctcaaaccaccgttgaagttgactccttgttcgatggtgaagactttgaagctaccatc
accagagccagattcgaagacatcaacgctgctctattcaagtctactctagaaccagtt
gaacaagttctaaaggatgctaagatctccaagtctcaaattgacgaagttgtcttggtt
ggtggttccaccagaattccaaaggtccaaaagttgctatctgacttctttgacggtaag
caattggaaaagtctattaacccagatgaagctgttgcttacggtgctgctgttcaaggt
gctatcttgaccggtcaatctacttctgacgaaaccaaggacttgttgttgttggatgtt
gctccattgtctttgggtgtcggtatggctggtgatgttttcggtgttgtcgttccaaga
aacaccaccgtcccaaccatcaagagaagaacattcacaactgttgctgaccaccaaact
actgttactttcccagtttaccaaggtgaacgtgttaactgtaaggaaaacaccttgttg
ggtgaattcgacttgaagggtgttccaccaatgccagctggtgaaccagttttggaagct
atcttcgaagttgatgctaacggtatcttgaaggtcactgccgtcgaaaagtccactggt
aaatctgctaacattaccatctctaacgctattggtagattgtcttctgaagaaatcgaa
caaatggttaaccaagctgaagagttcaaggctgctgacgaagctttcgctaagaagcac
gaagccagacaaagattggaatcatacatctcttccgttgaacaaactgtcaccgaccca
gttttgtccgccaagatcaagagaaacgctaaggctaaggttgaagctgctttggctgat
gctttctccaccttgcaaatcgaagatgcatctgctgacgatttgagaaaggctgaagtt
ggtttgaagagagctgtcaccaaggctatgtctacccgttaa

DBGET integrated database retrieval system