KEGG   Kluyveromyces marxianus: KLMA_60511Help
Entry
KLMA_60511        CDS       T05269                                 

Gene name
CPR6
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase D
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
kmx  Kluyveromyces marxianus
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:kmx03110]
    KLMA_60511 (CPR6)
Enzymes [BR:kmx01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     KLMA_60511 (CPR6)
Chaperones and folding catalysts [BR:kmx03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    KLMA_60511 (CPR6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_8 SIMPL
Motif
Other DBs
NCBI-GeneID: 34717723
NCBI-ProteinID: XP_022677580
Position
6:1084889..1086007
Genome map
AA seq 372 aa AA seqDB search
MSEARPKTFFDISIGGEPAGRIVFELYSDVVPKTAENFVKLCEGKSGFAKTKPDVPLSYK
GSIFHRVIKSFMCQFGDFTNFDGTGGESIYGEKFEDENFTIKHDKPFLLSMANAGANTNG
SQAFITCGPTPHLNGKHVVFGEVIQGKRLVRVIEKIETDDYDKPKKEVKIEDCGILPSDY
QVPADAEATPADKYGDNYEENLSDDIKVDLKDVNSVLKAVEAVKAIGTQQFKEKNFEVAL
EKYEKSSIMLRQFFPEDLPEEDILRVDTLRVSIFLNIAVTASKLKNYSRTLSAATEALHA
DNINDKSKAKALYHRGLAYYNTKNPEMAVTDLELASSYDAQNAAIQKALQEARVASKKLL
EQQKKSLSKMFG
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagctagaccaaagacattctttgacatatcaattggtggggaaccagcggga
agaattgtatttgaactatattctgatgttgtgccaaaaacagctgagaatttcgtgaaa
ttgtgtgaaggcaaatctggatttgctaaaacgaagccagatgtaccactttcatacaag
ggttcaatattccacagagttattaaatcattcatgtgccaatttggtgacttcaccaat
tttgacggcactggtggtgaatctatatacggtgagaaatttgaagatgaaaacttcacc
ataaaacatgacaaacctttcttgttgtctatggctaacgccggagctaataccaatggt
tcccaagcattcattacttgcggtccaactcctcatttgaatggaaagcatgtcgtcttt
ggtgaagtgatccagggtaaaagactagttagagtcatcgagaagattgaaactgatgac
tacgataagccaaaaaaggaagtaaaaattgaggactgtggtattttaccatcagactac
caagttccagctgatgccgaagcaactcctgccgataaatacggtgacaattacgaggaa
aatctctcagatgatataaaggttgatttgaaagacgtcaacagtgttttaaaggcagta
gaagctgtaaaagcgatcgggacacaacaattcaaagagaagaactttgaggtggcccta
gaaaagtacgaaaaaagttcaattatgttgagacaattcttccctgaagatttgccagaa
gaagatatcttgagagttgatactttgagagtatctatatttttgaatatcgctgtgaca
gcatctaaattgaaaaattacagcaggaccctcagtgcagctacagaagcccttcacgca
gacaacataaacgataaatcaaaggcaaaagcattatatcaccgtggtttggcctactac
aatactaaaaaccctgaaatggctgtaactgatctcgaacttgcaagttcatatgatgca
cagaatgcagccattcaaaaagctctacaagaagctagagttgctagcaaaaaactccta
gaacaacaaaagaagtctctatcgaagatgtttggttag

DBGET integrated database retrieval system