KEGG   Kluyveromyces marxianus: KLMA_80186Help
Entry
KLMA_80186        CDS       T05269                                 

Gene name
NIP1
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit C
  KO
K03252  translation initiation factor 3 subunit C
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx03013  RNA transport
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    KLMA_80186 (NIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:kmx03012]
    KLMA_80186 (NIP1)
Translation factors [BR:kmx03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    KLMA_80186 (NIP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF-3c_N PCI Arg_decarb_HB
Motif
Other DBs
NCBI-GeneID: 34718383
NCBI-ProteinID: XP_022678240
Position
8:412509..414968
Genome map
AA seq 819 aa AA seqDB search
MSRFFLKTYEYDSTSSGEEEDLLSQSEEDLLSSSSDEELSDDSFFNDSSDSSDNDEDNDS
DSKPYGPDWFKKPEFRKGGASGVNKFLKSTNYSSDEDSSDEEDGKKVVKSAKEKLLDEMK
SIYQKIDGAEAQQDWESLLNYLESVLKLYTRAQQQNYGTPNIYVKTLARFEDAVSATSQD
EIKNKAVARAYNTTRQRVKKLVRENEESLKAYRESPESFDKEPVLNNEADSREVSATPFS
LSTNKKLDLASMASNISEMDFFKTLNIIIDSRGKKNTDHQAQIRTTEELLKVASTPYEKI
CTYLNLIPIRFDASVSLSYQPLDQWKASKENLDGLLDLLEKEVDHYQVTEFAPRNDFIED
EPEANENGVKEILGSIFSMVERLDDEFTKSLLNIDTRSSEYMERLKDEQSMYNLIIRAQL
YFERVTPEEHRDRVLSRVFIRRLEHIYYKSSKLISIMETVAWKHIRDNTSASESSFIFLK
ESDVANEDYTFNVISELSDLLIKQKSNNFTGYQKGTLYKTYYIGLNKDYEEAKKLMLSSD
ITKSISGSDASLQILYNRCVIQLGLAAFKAGLINECHQVLNGLCINPHLREILGQQSLQR
ASANSNVVQGAPVEQLCIPFHQHINLDLIDTVYMTCSLLLDVPHMAAYYSGIKVQRIPVF
QKSIRRILESSEKAIFHGPPETLRDHILYAAKSMQKGDYLQSIEYLRKISVWSLLSKTDD
IINQLSEKVQIETLKTYIFTYKRFYTKISISKLSKLFDLDVEKVLEVAQSIINDYEVKAK
LDENNEYIVFERGEEITKLEEVAIKLVKETKYHSERLRQ
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtttttttctaaagacatatgagtacgactcgacgtcgtcgggagaagaagaa
gacttgttatctcaaagcgaggaagacttattgtcctctagcagcgatgaagagttatct
gacgactcctttttcaatgattcgtctgacagttcagacaatgatgaggataacgattcc
gatagcaagccatatggtccagactggttcaagaagcctgagttcagaaaaggtggtgct
tctggcgtgaacaagtttttgaagtctacgaattactcttctgatgaggactcttctgat
gaggaggatggtaagaaggttgtgaaatcagccaaggagaaattgttggatgaaatgaag
tctatttaccagaagatcgatggagctgaggctcagcaagactgggaatcactattgaac
tatttggaatctgttttgaaattatacacaagagctcagcagcagaattacggtactcct
aacatctacgtgaagacattggccagattcgaagatgctgtgtctgccacatcccaggat
gagatcaagaacaaggccgttgcaagagcctacaacactacaagacaaagagtgaagaag
ttggttagagaaaacgaggaatccttgaaggcttacagagagtctccagaaagcttcgac
aaggagccagtcttgaacaatgaagcagactccagagaagtttctgctactccattctct
ttgagcaccaacaagaaactagatttggcttctatggcaagcaacatctctgagatggac
ttcttcaagaccttgaacatcataattgactccagaggtaagaagaacaccgaccaccaa
gcacaaatcagaaccactgaagagcttttgaaggtcgcaagcactccatacgagaaaatt
tgcacttacttgaacttaattcctatcagattcgacgcatctgtttccttgtcataccaa
ccattggatcaatggaaagcttccaaggaaaacttggatggcctattggacctactggaa
aaggaagtcgatcactaccaagttaccgaattcgctcctagaaacgacttcattgaagat
gagccagaggctaacgaaaatggtgtgaaggaaatcttgggttccatcttctcaatggtt
gaaagattggacgatgaattcaccaaatccttgttgaacatcgacacccgttctagtgaa
tacatggaacgtttgaaggacgaacaatctatgtacaacttgatcatcagagctcaattg
tacttcgaacgtgtcaccccagaggaacaccgcgacagagtcttgtctcgtgtcttcatc
agaagactagaacacatctactacaaatcaagcaagctcatctccatcatggaaactgtt
gcttggaagcatatccgtgataatacttctgcctccgaatctagcttcatcttcttgaag
gaatccgatgttgctaacgaagattacacctttaacgtcatttcagaattgtccgactta
ttgatcaaacaaaagagtaacaactttactggttaccaaaagggtaccttgtacaagact
tactacattggtctaaacaaggattacgaagaagcaaagaaactaatgctatcatcagat
ataactaagtccatttctggctctgatgccagcttgcaaatcttgtacaatagatgtgtt
atccaactaggtttggctgcattcaaggctggcttaattaatgaatgtcaccaggttttg
aacggtctatgtatcaatccacacctaagagaaatcttgggtcaacaaagtctacaaaga
gctagtgcgaacagcaatgttgtgcagggcgcccctgttgaacaattgtgtattccattc
caccaacacatcaacttggatttgattgacaccgtctacatgacttgttctttgttgctt
gatgttcctcacatggctgcttactacagtggtatcaaggtccaaagaattccagtcttc
caaaaatctatccgccgtatcttagaaagttcagaaaaggctatcttccacggccctcca
gaaaccctcagagatcacatcctatacgctgctaagtcaatgcaaaagggtgactaccta
caatcaatcgaatacctaagaaaaatttccgtttggtctttgttgagtaaaactgatgat
atcattaaccagttaagtgaaaaggttcaaattgaaactttgaagacttacatcttcact
tacaagagattctacaccaagatctccatttccaaattatcaaaactgttcgatttagat
gttgagaaggttttggaggttgctcaatctatcatcaacgactacgaagttaaggctaag
ttggatgaaaataacgaatatattgtgtttgaaagaggtgaagaaatcaccaaattagaa
gaagttgctataaaattggtcaaggaaaccaagtaccattccgaacgtttacgtcaatag

DBGET integrated database retrieval system