KEGG   Kluyveromyces marxianus: KLMA_80276
Entry
KLMA_80276        CDS       T05269                                 

Gene name
ERG24
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
kmx  Kluyveromyces marxianus
Pathway
kmx00100  Steroid biosynthesis
kmx01100  Metabolic pathways
kmx01110  Biosynthesis of secondary metabolites
Module
kmx_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:kmx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    KLMA_80276 (ERG24)
Enzymes [BR:kmx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     KLMA_80276 (ERG24)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 34718470
NCBI-ProteinID: XP_022678327
Position
8:621903..623213
AA seq 436 aa
MSTLNPRTTHYEFSGPIGALAITVFLPALAILLNQMIRPDYYIKGLFSNFSWIEVWNRLD
PLSSYLFNGELWTYYTTWYFSLALLDVILPGTKLYGVELRDGSKLPYKINGISMSAALCL
VLAARYQLTNGEMPELEYLYTHQTDLCIITILFSFALATAVYIASFIPLVKPNKSGTNER
ILALGGNSGNIIYDWFIGRELNPRLGPLDIKLFSELRPGMLLWLLLNLSCLHHSYKEHGK
IIDSLLLINVLQGFYIFDGVLNEEGVLTMMDITTDGFGFMLAFGDLCLVPFTYCLQARYL
SVSPIVLGPLNCGLVVSVMLLGYWIFHSSNKQKSEFRQGNLPHMKSIQTERGTKLLCDSW
WAVSQHINYFGDLLISLSWCLCTGFQTPLTYYYFFYFTALLLHRQTRDEDKCRKKYGKSW
EEYEKKVPYKIIPYVY
NT seq 1311 nt   +upstreamnt  +downstreamnt
atgtctacattgaatccaagaacaactcattatgagttttcaggccccattggggctttg
gctattacagttttccttcctgcattggctattctactaaaccaaatgatcagacctgat
tattacattaaaggtttattcagcaatttcagttggatcgaggtgtggaacagattagat
cccctatcgagctatctcttcaacggggaattatggacgtattacaccacttggtacttt
tctttagcattactggacgtgattttgccaggaaccaaactatatggtgtagaattgaga
gatggatccaaattgccatacaagattaacggaatttcaatgtcagcagctctatgtttg
gttttggcagcaagataccaattgactaatggagaaatgccagaattagagtatttatac
actcatcagactgacctttgtataataaccatcttgttttcctttgcattggccactgct
gtatacattgctagcttcattccattagtcaagcctaacaaaagtggaaccaatgaacgt
atcctagctctgggcggtaattcaggtaacattatctatgattggtttattggtagggag
ttgaatcctagacttggtccattagatatcaaactattctctgaacttagaccaggaatg
ctactatggctattactaaacctatcatgcttgcatcattcatacaaggagcatggaaaa
ataattgactctctattgttgataaatgttttgcaaggtttctacatctttgatggtgtg
ctaaatgaggaaggtgtgctaacgatgatggacattacaacagatggatttggtttcatg
ttagcttttggagatttgtgtttggttccctttacctattgtttacaggctcggtacttg
tctgtttcccccattgttctcggtcccttgaattgtggattggttgtatcggttatgctg
ttaggatactggatcttccattcttcgaacaaacaaaagtcagagttcagacaaggaaat
ctaccacatatgaaatccattcaaaccgaaaggggcaccaaacttttgtgcgactcttgg
tgggcagtatcacaacatataaattactttggtgatctattaatttcattgagttggtgt
ttgtgtaccgggttccaaactccactaacttactattacttcttctactttacagcgcta
ctcttgcacagacagacaagggatgaagataaatgtagaaagaagtatggaaaatcatgg
gaggagtacgagaagaaagtgccatataagataatcccatatgtatattaa

DBGET integrated database retrieval system