KEGG   Komagataeibacter nataicola: B0W47_06395Help
Entry
B0W47_06395       CDS       T04737                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
kna  Komagataeibacter nataicola
Pathway
kna00361  Chlorocyclohexane and chlorobenzene degradation
kna00625  Chloroalkane and chloroalkene degradation
kna01100  Metabolic pathways
kna01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kna00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B0W47_06395
   00361 Chlorocyclohexane and chlorobenzene degradation
    B0W47_06395
Enzymes [BR:kna01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     B0W47_06395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase
Motif
Other DBs
NCBI-ProteinID: AQU87166
UniProt: A0A1U9RJT5
Position
complement(1320334..1321002)
Genome map
AA seq 222 aa AA seqDB search
MSLFKPKFITFDCYGTLIHFEMGETARKLYADVIAPEHMDQFVADFAGYRLDEVLGAWKP
YRYVVLGAIERTCKRWNIPFDVAVANKFYDAVPTWGPWPDVTEPLRRVAREFPLVILSNA
MNSQIHSNVANIDVPFHKVFTAEDAQAYKPRMRAFEYMFDQLGCGPEDILHVSSSLRYDL
MPARDLGIRNKVFVARGHEPSTPEYGYTEIRDIGGLPGVLGL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtccctttttaagcccaaattcatcactttcgactgctatggcacgctgatccatttc
gaaatgggtgagacggcccgcaagctctatgccgatgtcatcgcgcccgagcacatggac
cagttcgtggccgactttgccggctaccgccttgatgaagtgcttggcgcctggaagccg
taccgttacgtcgtgctgggcgcgatcgagcgcacctgcaaacgctggaacattccgttt
gatgttgccgtggccaataagttttacgatgcagtgccgacatggggcccgtggcccgat
gtaaccgagccgctgcgccgcgtggccagggagtttccgctcgtcattctgtccaacgcc
atgaattcgcagatccattccaatgtcgcgaatatcgatgtgcctttccataaggtgttc
acggcagaagacgcgcaggcctacaagccgcgcatgcgcgcgtttgaatacatgttcgat
cagctcggctgcgggccggaagacatcctgcatgtctcgtcttccctgcgttacgacctc
atgcccgcgcgtgaccttggcatccgtaacaaggtgttcgtggcccgtgggcatgaaccc
tccacgccggaatatggttataccgaaatcagggatatcggcggccttccgggcgttctg
ggcctgtaa

DBGET integrated database retrieval system