KEGG   Komagataeibacter nataicola: B0W47_12945Help
Entry
B0W47_12945       CDS       T04737                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
kna  Komagataeibacter nataicola
Pathway
kna00020  Citrate cycle (TCA cycle)
kna00620  Pyruvate metabolism
kna01100  Metabolic pathways
kna01110  Biosynthesis of secondary metabolites
kna01120  Microbial metabolism in diverse environments
kna01200  Carbon metabolism
Module
kna_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kna_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B0W47_12945
   00620 Pyruvate metabolism
    B0W47_12945
Enzymes [BR:kna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     B0W47_12945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AQU88219
UniProt: A0A1U9RN69
Position
2683124..2684617
Genome map
AA seq 497 aa AA seqDB search
MTSNPSSASTYDVVLIGGGIMSATLGALLRQLEPGLSIALFGRLDDVALESSNGWNNAGT
GHSALCELNYTPLRPDGTVDISKAVNVNEAFQVSRQFWSYLVETGQIASPRDFLNPIPHM
SFVWGAENVDFLRRRYAALQQHPLFEGMSFSTDEGQMRQWMPLVMQDRAPGQPLAATWHP
AGTDVNFGALTHRLIDLLASKPGFDLNLAHEVEDLTPTADGQWDIAVRAMHGGGERKVRA
KFVFVGAGGGALHLLQKSGIPEARGIGGFPVSGQFLRCTNPDVVRQHHAKVYGKASVGAP
PMSVPHLDTRVIDGRQGLLFGPYAGFSTKFLKQGSWLDLPRSIRMDNIGAMMAVARDNMP
LTKYLIQQVMQSNEDRLKALRDFVPTARKEDWELITAGQRVQVIKKDAKKGGVLQFGTEV
VTGGGGSIAGLLGASPGASTAAPIMLTVLQRCFADRLPQWEARLREMVPSYGTKLGQDAA
LCAQVRERTRNALQLEG
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacctcgaatccctcatccgcctccacttacgatgtggtcctgattggtggtggaatc
atgagtgcaacgctcggcgccctgctgcgccagcttgagcccggcctgtccatcgccctg
ttcgggcggcttgatgatgtggcgctggaaagctcgaatggctggaacaacgcgggcacc
ggccattccgccctgtgcgagctgaattacacccccctgcgccccgatggcacggtggat
atctccaaggccgtgaacgtgaacgaagcctttcaggtttcacgccagttctggtcctac
cttgtcgagaccgggcagatcgcctccccgcgtgacttcctcaaccccattccgcacatg
agctttgtgtggggggcggagaatgtcgatttcctgcgccgccgttacgccgccctgcag
cagcacccgctgttcgagggcatgtcgttcagcaccgatgaaggccagatgcgccagtgg
atgccgctggtcatgcaggaccgtgcccccggccagcccctggccgcgacatggcacccg
gcgggcacggacgtgaatttcggcgcgctgacccaccgcctgatcgacctgctggccagc
aagcccggctttgacctcaacctcgcccatgaggtcgaggacctgacgcccacggccgac
gggcagtgggacatcgcggtccgcgccatgcatggcgggggcgagcgcaaggtgcgcgcc
aaattcgtgtttgttggcgcaggcggcggcgcgctgcacctgctccagaaaagtggcatc
cccgaagcccgtggcattggcggctttcccgtcagcgggcagttcctgcgctgcaccaac
cccgatgtggtgcgccagcatcacgccaaggtgtatggcaaggcctcggtcggcgcgccg
cccatgtcggtgccgcatctcgacacccgcgtgatcgatggcaggcaggggctgctgttt
ggcccctatgccgggttctcgaccaagttcctcaaacaggggtcctggctggacctgccg
cgctccatccgcatggacaatatcggggcgatgatggcggtcgcgcgcgacaacatgccg
ctgaccaaatacctgatccagcaggtcatgcagtccaacgaggaccggctcaaggcgctg
cgcgacttcgtgcccaccgcccgcaaggaggactgggaactgattaccgcaggccagcgc
gtgcaggtgatcaagaaagacgcgaaaaaaggcggcgtattgcagttcggcacggaggtc
gtgaccggcggcggcgggtccatcgcggggctgctcggcgcgtcgcccggtgcctccacc
gcggctcccatcatgcttacggtgctacagcgctgttttgccgaccgcctgccgcagtgg
gaggcgcgcctgcgtgagatggtgccctcttacggcacgaagctcgggcaggatgcggcc
ttgtgcgcgcaggtgcgcgagcgcacccgtaatgccctgcagcttgagggctga

DBGET integrated database retrieval system