KEGG   Komagataeibacter nataicola: B0W47_15755Help
Entry
B0W47_15755       CDS       T04737                                 

Definition
(GenBank) hypothetical protein
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
kna  Komagataeibacter nataicola
Pathway
kna00260  Glycine, serine and threonine metabolism
kna00620  Pyruvate metabolism
kna00630  Glyoxylate and dicarboxylate metabolism
kna01100  Metabolic pathways
kna01110  Biosynthesis of secondary metabolites
kna01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B0W47_15755
   00630 Glyoxylate and dicarboxylate metabolism
    B0W47_15755
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B0W47_15755
Enzymes [BR:kna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     B0W47_15755
    1.1.1.81  hydroxypyruvate reductase
     B0W47_15755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 ApbA
Motif
Other DBs
NCBI-ProteinID: AQU88654
UniProt: A0A1U9RP20
Position
3277029..3277976
Genome map
AA seq 315 aa AA seqDB search
MVSIAVYVEDDADYFRLVKEAFAERAPDIDVVDWAAALRAPDRIDYALVWIPPIGDLARL
SALRAVFSLSAGVDHIVARDPDWPAHLPLIRMAGEETGRLMADYLLWACISVIRGARGWA
LQQNERVWKRTVVTRSTSDCVVGIMGLGQLGRYAAGHLSRCGFVVQGWSRSPKVIEGVRT
FDGAAGLEPFLAGTDILICLLPNTPETRNIINARVLRALRPGGAFINVGRGEHVVESDLL
SALDDGVLSAAVLDVFQHEPLPVTSPLWVHPSVIVTPHIASQASVCARVDYLIGCIRRLQ
RGERPEQVFDISRGY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggtttccatcgccgtttatgttgaagacgatgctgactatttcaggctggtaaaggaa
gcgtttgccgaacgggcgcctgatatcgatgtggtggactgggcggcggccctgcgggcg
cccgacaggattgattacgcgctggtatggataccccccataggcgatctggcgcgcctg
tcggccctcagggcagttttcagcctgtctgccggggttgatcatattgtggcgcgcgat
cccgactggcccgcccatctgccccttatccgcatggcgggggaggaaaccgggcgcctg
atggcggattacctgttatgggcctgtatcagcgtaatccgtggtgcgcgggggtgggcg
ttgcaacagaacgagcgggtgtggaaacgcacggtcgtcacgcgttcgacttcggactgt
gtggtgggcatcatggggcttgggcagcttggccgttacgcggccgggcatctcagccgg
tgtggctttgtcgtgcagggatggtcgcgctcgcccaaggtgatcgagggtgtcaggact
tttgacggggcggccgggctggaaccatttctggccgggaccgatatcctcatctgcctg
ctgcccaatactcccgagacccgcaacatcatcaatgcccgggtgctgcgcgcgctccgg
cccggaggggcgttcatcaatgtcgggcgcggggagcatgttgttgaaagcgatctttta
tcggcacttgatgatggcgtgctgtcagccgctgttctggatgtttttcagcatgaaccg
ctaccggtgacctcgcccttgtgggtgcacccatccgtcattgtcaccccgcatatagca
tcccaggcatcggtctgtgcccgggtcgattatctgattggctgcataaggcgcctgcag
cgcggggaacgcccggagcaggtttttgatatcagccggggttactga

DBGET integrated database retrieval system