KEGG   Klebsiella oxytoca CAV1374: AB185_05480Help
Entry
AB185_05480       CDS       T04534                                 

Definition
(GenBank) PTS system fructose transporter subunit IIB
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00051  Fructose and mannose metabolism
koc01100  Metabolic pathways
koc02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:koc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AB185_05480
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    AB185_05480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:koc02000]
    AB185_05480
Enzymes [BR:koc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     AB185_05480
Transporters [BR:koc02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    AB185_05480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb PH_TFIIH
Motif
Other DBs
NCBI-ProteinID: AKL33398
UniProt: A0A0G3S2A2
Position
36411..36905
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVYNDDVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTNPQDVLTMVQQGVKIATLNIGGMAWRPGKKQLTKAV
SLDAADINAFQQLDTLGVKLDLRVVASDPSVNILDKIAEQSVTE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcacgcattgatgaccgcctgattcacggccaggtcaccaccgtt
tggtcaaaagtggccaacgcccagcgtatcattatctgtaatgacgacgtgtataacgac
gacgttcgccgcacgctgcttcgccaggccgcgccgccgggcatgaaggtcaatgtggtg
aatatcgagaaagccgtcgccgtttatcacaacccgcaatatcaggacgaaacggttttt
tatttattcactaatccgcaggacgtattaaccatggtacaacagggcgtcaaaatagcc
acgctgaatattggcggcatggcctggcgaccgggtaaaaaacagttaaccaaagcggtg
tcattagacgcagcggatattaatgcctttcagcagttagatactctgggcgttaagctt
gatttacgcgtcgtggcttcggatccgtcggttaatattctcgataaaatagcagagcag
tccgttacagaataa

DBGET integrated database retrieval system