KEGG   Klebsiella oxytoca CAV1374: AB185_06925Help
Entry
AB185_06925       CDS       T04534                                 

Definition
(GenBank) alpha-D-glucose-1-phosphatase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00010  Glycolysis / Gluconeogenesis
koc01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:koc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AB185_06925
Enzymes [BR:koc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     AB185_06925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Acid_PPase HAD PNK3P SHOCT Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AKL33644
UniProt: A0A0G3S0D4
Position
complement(348182..348781)
Genome map
AA seq 199 aa AA seqDB search
MLYIFDLGNVIVDIDFNRVLGTWSDLTRIPLATLQQHFTMGEAFHQHERGEISDEDFAAA
MCHEMNMSLSYEQFSHGWQAVFVALRPEVIAIMQKLREQGHRVVVLSNTNRLHTTFWPDE
YPEIRAVADHIYLSQEMGMRKPEARIYQSVLDAEGFAADDTVFFDDNADNIAGANQLGIT
SILVTGKETIPNYFAKQLC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgctctatatctttgatttaggtaatgtgattgtcgatattgacttcaaccgggtgctc
gggacgtggagtgatttaacgcgcattccccttgcgacgctgcagcagcatttcaccatg
ggcgaagcgttccaccagcatgagcgcggtgaaatcagcgacgaagattttgcggcggcg
atgtgccatgaaatgaacatgtcgctaagctacgagcagttctcccacggctggcaggcg
gttttcgttgccctgcgcccggaggttatcgcgattatgcaaaaattacgcgagcagggg
catcgcgttgtggttctgtccaacacgaaccgtttgcatacgactttctggccggatgag
taccctgagatacgcgccgttgctgatcatatctatctttctcaagagatggggatgcgt
aaaccggaagcgcggatctatcagagcgtcctcgacgctgaaggtttcgccgctgacgat
acggtcttcttcgatgataacgcggacaatatcgccggggctaaccagctgggcataacc
agtattctggtgaccgggaaggaaaccatccccaactactttgctaaacagctatgctaa

DBGET integrated database retrieval system