KEGG   Klebsiella oxytoca CAV1374: AB185_09305Help
Entry
AB185_09305       CDS       T04534                                 

Definition
(GenBank) peptidylprolyl isomerase
  KO
K03775  FKBP-type peptidyl-prolyl cis-trans isomerase SlyD [EC:5.2.1.8]
Organism
koc  Klebsiella oxytoca CAV1374
Brite
KEGG Orthology (KO) [BR:koc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:koc03110]
    AB185_09305
Enzymes [BR:koc01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     AB185_09305
Chaperones and folding catalysts [BR:koc03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    AB185_09305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: AKL34084
UniProt: A0A0G3S1L8
Position
888399..888986
Genome map
AA seq 195 aa AA seqDB search
MKVAKDLVVSLAYQVRTEDGVLVDESPVSAPLDYLHGHGSLISGLENALDGHDVGDKFDV
EVGANDAYGQYDENLVQRVPKDVFMGVDELQVGMRFLAETDQGPVPVEITEVGDEHVVVD
GNHMLAGQNLKFNVEVVAIREATAEELEHGHVHGAHGHDHGHDHDHDGCCGGHGHGHDHE
HGKGGCGGNGGCGCH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtagcaaaagacctggtggtcagcctggcctatcaggtacgtacagaagacggt
gtgttggttgatgagtctccggtaagcgcgccgcttgactacctgcatggtcacggttcc
ctgatttccggcctggaaaacgcgctggacggccacgacgttggcgacaaatttgacgtc
gaagtcggcgctaacgatgcatacggtcagtacgacgaaaacctggttcagcgcgttcct
aaagacgtatttatgggcgttgatgaactgcaggttggcatgcgcttcctggcggaaacc
gatcagggtccggtaccggtagaaatcaccgaagtgggtgacgaacacgttgttgttgac
ggtaaccacatgctggctggtcagaatctgaagttcaacgttgaagttgtcgcgattcgc
gaagcaacggcggaagagctggagcatggtcatgtacacggtgctcacgggcacgatcat
ggccacgaccacgatcatgatggttgctgcggtggccacggccacggccatgaccacgaa
catggcaaaggcggctgcggcggcaacggcggctgcggctgccactaa

DBGET integrated database retrieval system