KEGG   Klebsiella oxytoca CAV1374: AB185_11635Help
Entry
AB185_11635       CDS       T04534                                 

Gene name
gcvT
Definition
(GenBank) glycine cleavage system protein T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00260  Glycine, serine and threonine metabolism
koc00630  Glyoxylate and dicarboxylate metabolism
koc00670  One carbon pool by folate
koc01100  Metabolic pathways
koc01110  Biosynthesis of secondary metabolites
koc01130  Biosynthesis of antibiotics
koc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:koc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AB185_11635 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AB185_11635 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AB185_11635 (gcvT)
Enzymes [BR:koc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     AB185_11635 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD
Motif
Other DBs
NCBI-ProteinID: AKL38773
UniProt: A0A0G3SHB4
Position
1352155..1353249
Genome map
AA seq 364 aa AA seqDB search
MAQQTPLFEQHTLCGARMVDFHGWMMPLHYGSQIDEHHAVRGDAGMFDVSHMTIVDFHGS
RIREFLRYLLANDVAKLTVPGKALYSGMLTASGGVIDDLIVYFLSEDYFRLVVNSATREK
DLAWITQQSESYGLEITVRDDLSLIAVQGPKAKEKAATLFTDAQRQAVEGMKPFFGVQAG
DLFIATTGYTGEAGYEIALPNEQAVDFWRGLLDAGVKPCGLGARDTLRLEAGMNLYGQEM
DEGVSPLAANMGWTIAWEPADRDFIGREALELQREKGTEQLVGLVMTEKGVLRGGLPVRF
SDADGNQKEGIITSGTFSPTLGYSIALARVPEGIGETAVVQIRNREMPVKVTKPVFVRNG
KAVA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctcaacagactccgttgtttgaacaacatacgctatgcggcgcgcgcatggtggat
ttccatggctggatgatgccgctgcattacggatcccagatcgatgagcatcatgcggtg
cgcggtgatgccggaatgttcgacgtgtcgcacatgaccatcgtcgattttcacggcagc
cgaatccgcgagttcctgcgctatctgctggctaacgacgtggcgaagctcaccgtgccg
ggcaaagcgctctatagcggcatgctgaccgcctccggcggcgtcattgatgacctgatt
gtttatttcctttctgaagactatttccgcctcgttgttaactccgccacccgtgaaaaa
gacctcgcctggatcacccagcagtctgaatcctatggtcttgagataaccgtgcgtgac
gatctatccctgatcgccgtacagggtccaaaggcgaaagagaaagcggcgacgctgttt
accgacgcgcagcgccaggccgtggaaggcatgaagccgttctttggcgtgcaggcgggc
gatctgtttattgcgactaccggctataccggtgaagcgggttatgaaatcgcgctgccg
aacgagcaggcggtggatttctggcgcggtctgctggacgcgggcgttaagccgtgcggc
cttggcgcgcgcgatacgctgcgcctggaagcgggcatgaatctttatggccaggagatg
gacgaaggcgtctctccgctggcggctaacatgggctggaccattgcctgggaaccggct
gaccgtgattttatcgggcgtgaagcgctggaactccagcgtgaaaaaggcaccgaacag
ctggtcggcctggtgatgaccgagaaaggcgttctgcgcggcggcctgccggtgcgcttc
agcgatgccgatggcaatcagaaagaaggcattatcaccagcggcaccttctccccgacg
ctgggctacagtattgccttagcgcgcgtaccggaaggcatcggtgaaaccgccgtggtg
cagattcgcaatcgcgaaatgccggtcaaagtgaccaaacccgtttttgtacgcaacggc
aaagccgtggcgtga

DBGET integrated database retrieval system