KEGG   Klebsiella oxytoca CAV1374: AB185_11885Help
Entry
AB185_11885       CDS       T04534                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00071  Fatty acid degradation
koc00280  Valine, leucine and isoleucine degradation
koc00310  Lysine degradation
koc00362  Benzoate degradation
koc00380  Tryptophan metabolism
koc00620  Pyruvate metabolism
koc00630  Glyoxylate and dicarboxylate metabolism
koc00640  Propanoate metabolism
koc00650  Butanoate metabolism
koc00900  Terpenoid backbone biosynthesis
koc01100  Metabolic pathways
koc01110  Biosynthesis of secondary metabolites
koc01120  Microbial metabolism in diverse environments
koc01130  Biosynthesis of antibiotics
koc01200  Carbon metabolism
koc01212  Fatty acid metabolism
koc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:koc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AB185_11885
   00630 Glyoxylate and dicarboxylate metabolism
    AB185_11885
   00640 Propanoate metabolism
    AB185_11885
   00650 Butanoate metabolism
    AB185_11885
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AB185_11885
   00072 Synthesis and degradation of ketone bodies
    AB185_11885
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AB185_11885
   00310 Lysine degradation
    AB185_11885
   00380 Tryptophan metabolism
    AB185_11885
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AB185_11885
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AB185_11885
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AB185_11885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:koc04147]
    AB185_11885
Enzymes [BR:koc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AB185_11885
Exosome [BR:koc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AB185_11885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III HemY_N
Motif
Other DBs
NCBI-ProteinID: AKL34556
UniProt: A0A0G3S2S2
Position
complement(1404588..1405778)
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVVVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGLAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVIACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILSWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEDRFREQILALEVPDGKKATRLFATDEHPRDTPREKLAALRPVFKAD
GVVTAANSSGINDGAAALVMMTRQQAEQRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNMDVHAIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacacaggctaatgatattgtggttgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaagcatacccaccagcacgatctcggggcagcggttattcgcgaagcg
atcgcccgcgccgggcttgcgccgcaggatatcgatgaaacgatcgtcggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgccagctgcgggcggggatcccgcag
gagagcaccgcgtattcggttaaccgccagtgcggctccgggcttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcatcgcctgcggaacggaaaat
atgacccagttgccctactacctgcgcaaagcgcgcgatggctatcgcatgggccacggc
gagctggaagatggactgatctccatccttagctggccagaagggccttatcacaacggc
atcacggcggaaaacgtcgcgcaacgcttcggtattacccgtgaagcgatggacgatttc
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggaggatcgcttccgcgagcag
attctggcccttgaggtgccggacggcaaaaaagcgacccgcctgttcgcgaccgatgaa
cacccgcgcgacaccccgcgcgaaaagctcgccgcgctgcgtccggtatttaaagccgac
ggcgtagtgacggcggccaactcctccggcattaacgacggcgcagccgcgctggtgatg
atgacccgccagcaggcggaacagcgcggcttaactccgcgcatgcggattcgcggctgg
gcggtcgccggctgcggcgcggagattatggggtttggcccctctcccgctacccgacgc
ctgatggaccgtctcaatatggatgttcacgccatcgatttaattgaactcaatgaggcc
ttcgccgcccaggcgctggcggtgatgaacgatctgcgtctcgatccagcccgcgttaac
gtcaacggcggcgcgatcgccctcggccacccggtgggcgccagcggtgcgatcctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcgcgcaccggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system