KEGG   Klebsiella oxytoca CAV1374: AB185_27495Help
Entry
AB185_27495       CDS       T04534                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
koc  Klebsiella oxytoca CAV1374
Pathway
koc00630  Glyoxylate and dicarboxylate metabolism
koc00660  C5-Branched dibasic acid metabolism
koc01100  Metabolic pathways
koc01120  Microbial metabolism in diverse environments
koc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:koc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AB185_27495
   00660 C5-Branched dibasic acid metabolism
    AB185_27495
Enzymes [BR:koc01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     AB185_27495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C
Motif
Other DBs
NCBI-ProteinID: AKL37411
UniProt: A0A0G3SAV1
Position
4704108..4705349
Genome map
AA seq 413 aa AA seqDB search
MKIKQALFTAGYSSFYFDDQQAIKNGAGHDGFIYTGAPVTPGFTSVRQAGECVSVQLILE
NGAVAVGDCAAVQYSGAGGRDPLFLAENFIPFLNDHIKPLLEGRDVDTFLPNARFFDKLR
IDGHLLHTAVRYGLSQALLDATALASGRLKAEVVCDEWQLPCIPEAIPLFGQSGDDRYIA
VDKMILKGVDVLPHALINNVEEKLGLKGEKLREYVRWLSDRILSLRTSPRYRPTLHIDVY
GTIGLIFDMDPVRCADYIASLEQEAQGLPLYIEGPVDAGNKPDQIRMLTAITKELTRLGS
GVKIVADEWCNTYQDIVDFTDAGSCHMVQIKTPDLGGIHNIVDAVLYCNKHAMEAYQGGT
CNETEISARTCVHVALAARPMRMLIKPGMGFDEGLNIVFNEMNRTIALLQTKD
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaacaggcccttttcaccgctggctactcttcattctattttgacgatcag
caggcgattaaaaacggcgcgggtcatgatgggttcatttataccggtgctccggtaacg
ccaggcttcacctcggtacgccaggcgggtgaatgcgtatccgtccagctgattctggaa
aacggcgcggtggcggtcggtgactgtgccgccgtacagtactccggcgcgggcggccgc
gacccgctgttcctggcggagaactttatcccgttcctcaacgatcatatcaaaccgctg
ctggagggccgcgatgtcgataccttcctgccgaacgcccgcttcttcgacaagctgcgc
atcgacggtcatctgctgcataccgccgtccgctacggtctttcccaggcgctgctcgac
gccaccgcgctggccagcggccgcctgaaggcggaggtagtttgcgacgaatggcagttg
ccctgcataccggaagcgattccgttatttggtcagagcggcgacgaccgctacatcgcc
gtggacaaaatgatcctcaaaggcgttgacgtcctgccgcatgcgctcattaacaacgtc
gaagagaagctgggtctgaaaggggaaaaactgcgtgagtatgtccgctggctgtccgac
cgcatcttaagcctgcgcaccagcccccgctatcgccccacgctgcatatcgacgtgtac
ggcaccatcggcctgattttcgatatggatccggttcgctgcgccgactatatcgccagc
ctggagcaagaggcgcagggcctgccgctctacatagaaggcccggtggatgcgggtaat
aaaccggaccagatccgtatgctcacggccattaccaaagagctgactcgcctcggttcc
ggcgtaaaaattgtcgccgacgagtggtgtaacacctaccaggacatcgttgactttacc
gatgccggcagctgccacatggtgcagatcaaaaccccggatctcggcggcattcataac
atcgtggacgcagtgctgtactgcaacaaacacgcgatggaagcctatcagggcggtacc
tgtaacgaaaccgagatcagcgcccgcacctgcgttcacgtcgcgctggccgcgcgtccg
atgcgcatgttgatcaagccgggcatgggcttcgacgaaggtcttaacatcgtgtttaac
gaaatgaaccgcaccatcgcgctgttgcagactaaggattaa

DBGET integrated database retrieval system