KEGG   Klebsiella oxytoca CAV1374: AB185_31755Help
Entry
AB185_31755       CDS       T04534                                 

Gene name
apaG
Definition
(GenBank) heavy metal transporter
  KO
K06195  ApaG protein
Organism
koc  Klebsiella oxytoca CAV1374
Brite
KEGG Orthology (KO) [BR:koc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    AB185_31755 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 Pax2_C DUF4354
Motif
Other DBs
NCBI-ProteinID: AKL38209
UniProt: A0A0G3SD81
Position
5657433..5657810
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCVQVQSVYIESQSSPQEERYVFAYTVTIRNLGRTQVQLLGRYWLITNGHGRET
EVQGEGVVGEQPHIPAGGEYQYTSGAVIETPLGTMQGHYAMIDVNGAPFTIEIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgattaattcgccccgagtttgtgtacaggtgcaaagcgtctacatcgaatcgcaatct
tctccgcaagaagagcgctacgtcttcgcttataccgtgaccattcgcaatctggggcgg
acgcaggttcagcttcttggccgctactggcttatcaccaacggccacggtcgtgagacc
gaagtccagggtgaaggcgtggtcggcgagcagccgcatattccggccggcggcgaatat
caatataccagcggcgcggtcattgaaacgccgctgggcaccatgcagggacattatgcg
atgatcgatgtgaacggcgcgccgttcaccatcgaaatccctgttttccgtctcgcagta
cccactctcatccattaa

DBGET integrated database retrieval system