KEGG   Klebsiella michiganensis E718: A225_1544Help
Entry
A225_1544         CDS       T02173                                 

Definition
(GenBank) Oxygen-insensitive NAD(P)H nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00633  Nitrotoluene degradation
koe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    A225_1544
Enzymes [BR:koe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     A225_1544
  1.-  
   1.-.-  
    1.-.-.-  
     A225_1544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase GramPos_pilinD1 TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AFN31284
Position
complement(1619314..1619967)
Genome map
AA seq 217 aa AA seqDB search
MDIVSVALKRYSTKAFDATKKLTAEQAENLKTLLQYSPSSTNSQPWHFIVASSDEGKARV
AKAASGTYVFNERKILDASHVVVFCAKTAMDDAWLERVVNQEEADGRFANADAKAANHKG
RTFFADMHRKELHDDDQWMAKQVYLNVGNFLLGVAAMGLDAVPIEGVDFAILDAEFDLKA
QGYTSLVVVPVGHHSVEDFNATLPKSRLPQATTITEI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtatcggttgccttaaagcgctactccaccaaggcatttgacgccaccaaa
aagctaactgccgagcaggcggaaaacctgaaaacgctgctgcagtacagcccgtcaagc
accaactcccagccgtggcactttatcgttgccagcagcgatgaaggcaaagcgcgcgtt
gccaaagcggcgagcggcacctacgtgtttaacgaacgtaaaattctcgatgcctcccac
gtggtggtgttctgcgccaaaaccgcaatggacgacgcctggcttgagcgcgtggtgaac
caggaagaggccgatggccgcttcgcaaacgccgacgccaaagccgcgaaccataaaggc
cgcaccttctttgccgatatgcaccgcaaagagctgcacgacgacgatcagtggatggcg
aagcaggtttatctcaacgtcggcaacttcctgctgggcgtggcggcaatgggcctggac
gccgtgccgattgaaggcgtcgatttcgcgattctcgatgccgaattcgacctgaaagcc
cagggctacaccagcctggtggtggtgccggtcggccatcatagcgtcgaagacttcaac
gcgacgctgccgaaatcacgcctgccgcaggcgacgaccattaccgagatttaa

DBGET integrated database retrieval system