KEGG   Klebsiella michiganensis E718: A225_2526Help
Entry
A225_2526         CDS       T02173                                 

Definition
(GenBank) putative metal-dependent phosphoesterases (PHP family)
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
koe  Klebsiella michiganensis E718
Brite
KEGG Orthology (KO) [BR:koe00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A225_2526
Enzymes [BR:koe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     A225_2526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AFN32095
Position
2669038..2669907
Genome map
AA seq 289 aa AA seqDB search
MSNTNYAVIYDLHSHTIASDGRLTPEELVHRAHQMRVGTLAITDHDTVAAIPAAQREIER
AGLPLALITGVEISTLWENHEIHIVGLNIDIHHPAMTALLDEQKARRQMRGQQIAERLEK
ARIPGAWEGALKLADGGAVTRGHFARFLVEAGYANNMADVFKKYLARGKTGYVPPQWCTI
KQAIDVIHHSGGKAVIAHPGRYDLSAKWLKRLLAHFSEQGGDAMEVAQCQQAPHERAQLA
AYAVQYGLDASQGSDFHQPCPWIELGRKLWLPAGVEGIWRSWEVAVEQN
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
ttgagcaacaccaattacgcagtgatttacgacctgcacagccataccatcgcctctgac
gggcgtctgactccagaagaacttgtccatcgcgcccaccagatgcgcgtcggcaccctg
gcgattaccgaccacgataccgtggcggcaattcccgcggctcagcgtgaaattgaacgt
gccggtttaccgttggcgctgattaccggggtggaaatttccacgctgtgggaaaatcat
gaaattcatattgtcgggctgaatatcgatatccaccatccggcgatgaccgcgctgctc
gatgaacagaaagcgcgtcgccagatgcggggtcagcagatcgccgagcggcttgaaaaa
gcgcggatccctggcgcctgggaaggggcgctgaagctggcggacggcggtgcggtgacg
cgcggccattttgcccgttttctggtggaggccggctatgccaacaatatggctgacgta
tttaagaagtatctggcgcgcgggaaaaccggttacgttccgcctcagtggtgtacaata
aaacaagcgattgatgtcattcatcattctggcggtaaagcggtcattgcccatcccggg
cgctacgatctctccgccaagtggttaaaacggctgttggcccattttagcgagcagggg
ggcgatgcgatggaggtggcgcagtgtcagcaggcgcctcacgagcgcgcacagcttgcc
gcttacgccgtgcagtatggcctggatgcctcgcaggggtctgattttcatcagccctgc
ccgtggatcgaactgggccgcaaactttggctacccgcgggcgtggaagggatctggcgc
agttgggaagtggccgtagaacaaaattga

DBGET integrated database retrieval system