KEGG   Klebsiella michiganensis E718: A225_2530Help
Entry
A225_2530         CDS       T02173                                 

Definition
(GenBank) Beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00460  Cyanoamino acid metabolism
koe00500  Starch and sucrose metabolism
koe01100  Metabolic pathways
koe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A225_2530
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    A225_2530
Enzymes [BR:koe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     A225_2530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like PTAC
Motif
Other DBs
NCBI-ProteinID: AFN32098
Position
2673383..2675743
Genome map
AA seq 786 aa AA seqDB search
MNNDFNTTLAAMSAEEKVALLTGSGLWRTASLPQHGIEDIIMTDGTYGVRYSSAQIDGRE
KWSMDDFISVITQTADQASAEEPAAKGGSEALFSTSLPATCFPNGSSLACSWDVELVHQM
GEALGRECQQMGVGILLGPGINIRRTPLAGRGYEYYAEDPVVSGDIAAALINGLQQEGVG
ASLKHFAANNSEYRRTEMDSIIEERALREIYLAGFQRAIAKSRPWTVMSSYNRLNGVQTS
QDPFLLTQVLRDEWGYEGLVMSDWYGIKDRPASLMAGNDLAMPETRRDKQTLLAAIEAGE
VPMAVVDRACLRMLELLDKVQRHRRPQTRADFTAHHALAQRLAGESIVLLKNEDNLLPLR
PEKTPRVAVLGKPAQEPVIQGSGCATTVPYLLDRPLDEIFDLAGDDFSVSWAVGAPDDLR
CDEQALAQACRVAQEADVAVIFVSTAVGEDGENGDRQDLHILPVHERLIREVATVQPNIV
VVLANSDAVVMPWLGECKALLETFFAGQGMGRAVAEILFGQRNPCGKLTVTVPNSLEETP
AWLHYPGENLRHHYGEGLFVGYRYYDKRRMTPQFPFGFGLSYTRFAYDNIALSACRAGAG
ETLTVSFDLTNCGEYAGKEIVQLYVSAPKGELIREVQSLKAFSKVALAAGETRRVSLQLP
IGELACYHPGLGDWVVTPGIWQVRVGASSRDLPLIAEIEVDCPQRYVPLRDDNSLQQLIQ
QPEAFARVVKLIADKSQMPAEQVREKLIRLAPDLFCGLLIALTEFLALDIERDELNAVLA
GAHHCQ
NT seq 2361 nt NT seq  +upstreamnt  +downstreamnt
atgaataacgattttaacaccaccctcgccgcgatgagcgcggaagaaaaagtggcgctg
ctgaccggcagcggcctgtggcggacggcctcgctgccgcagcacggtatcgaagatatc
attatgaccgacggcacctacggcgtgcgctacagcagcgcgcagattgatggccgggaa
aagtggagcatggatgattttatctcagtcatcacccaaaccgcagatcaggccagcgcg
gaagagcccgccgcgaaaggggggagtgaagcgctattcagcacttcgctaccggcgacc
tgttttcctaatggttccagcctggcctgcagctgggacgtggagctggtgcatcagatg
ggggaagcgctggggcgggagtgtcagcaaatgggcgtcgggatcctgctcgggccgggg
attaacattcgccgtacgccgctggccgggcgaggctatgaatattacgccgaagatccg
gtggtcagcggcgatattgccgctgcgctgatcaacggcctgcagcaggagggggttggc
gccagcctgaaacactttgcggcgaacaactcggagtaccgccgcacggaaatggattcg
attattgaagaacgggcgctgcgggaaatctatctggcgggtttccagcgcgcgattgcg
aaatcccggccgtggacggtgatgtcttcctacaatcgtcttaacggcgtgcaaacctcc
caggatccgtttttgctcacccaggttttgcgcgatgagtggggatatgaagggctggtg
atgtccgactggtacggtattaaagatcgccccgcatcgctgatggcgggtaacgatctg
gcgatgcccgaaacccgccgcgataaacaaaccctgctggcggcgattgaagccggagag
gtgccgatggcggtggtggaccgcgcctgtctccgcatgctggaactgctcgacaaggtc
cagcgccatcgccgcccgcaaacgcgagccgattttacggcgcaccacgcgctggcgcag
cggcttgccggtgaatccattgtcttgctgaaaaatgaagataatctgctgccgctgcgt
ccggagaaaacgccgcgcgtcgcggtgctgggtaaaccggctcaggagccggtgatccag
gggtccggatgcgcgaccacggtgccgtatctgctcgatcggccgctggatgaaattttc
gacctcgccggcgacgacttcagcgtctcctgggccgtgggcgcgccggacgatctgcgc
tgcgatgaacaggcgctggcgcaggcctgccgcgtcgcgcaggaagccgacgtggcggtg
atcttcgtcagcaccgccgtaggcgaagatggcgagaacggcgatcgtcaggatctgcat
attctgccggtgcacgaacggttaattcgcgaagtggcgacggtccagccgaatatcgtg
gtggtgctggcgaatagcgatgcggtggtgatgccgtggctcggcgagtgcaaagcgctg
ctggaaacgttctttgccgggcaagggatggggcgcgcggtggcggaaatcctcttcggc
cagcgtaacccctgcggcaaactgacggtaacggtacctaattccctggaggaaacgccg
gcctggctgcactatccgggcgaaaacctgcgtcatcattacggagaagggctttttgtc
ggctatcgctattatgataaacgtcgcatgacgccgcagtttccgtttggctttggctta
agctatacccggtttgcgtacgataatatcgcgctgtcagcctgccgtgcaggcgcaggc
gagacgcttaccgtgtcgttcgacctgaccaactgcggagagtatgcgggcaaagagatc
gtccagctgtacgttagcgcgccgaagggggagctgattcgcgaagtgcagtcattaaaa
gcgttcagcaaagtggcgctggccgccggagagacccgtcgtgtgagcctgcagctgccc
attggcgagctggcctgctatcatccgggcctgggtgattgggtcgtgacgccgggcatc
tggcaggttcgcgtcggcgcctcatccagggatctgccgttgatcgcggagattgaggta
gattgtccgcagcggtacgtcccgctgcgcgatgataactctctacaacagctgatccag
cagccagaggcctttgcccgcgtagtgaagctgattgccgataagagccagatgccggcg
gagcaggtgcgtgaaaaactgattcgcctggcgccggatctgttctgcgggctgctgatt
gcactgaccgaattcctggcgctggatatcgaacgcgacgagcttaacgccgtgctggcc
ggcgctcatcattgccaatga

DBGET integrated database retrieval system