KEGG   Klebsiella michiganensis E718: A225_2626Help
Entry
A225_2626         CDS       T02173                                 

Definition
(GenBank) Uncharacterized protein ImpB
  KO
K11901  type VI secretion system protein ImpB
Organism
koe  Klebsiella michiganensis E718
Brite
KEGG Orthology (KO) [BR:koe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:koe02044]
    A225_2626
Secretion system [BR:koe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A225_2626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA GerD
Motif
Other DBs
NCBI-ProteinID: AFN32184
Position
2770900..2771391
Genome map
AA seq 163 aa AA seqDB search
MADTFQNEVPKARINLKLALHTGGAQKKVELPLKLLTIGDFSNGKEDRPLSERAKINVNK
NNFNSVLSEFSPEISLTVQNTLAGDSAEENIQLRFADMKDFEPEQVARQIPQLRAMLAMR
NLLRDLKSNLLDNATFRKELEKILKDPALTQELRDEMSALAPK
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggctgatacgttccagaatgaggtgcccaaggcacgcattaatttaaagctggctctg
cacacaggaggcgcgcagaagaaagtcgagctgccgctgaaactcctcaccatcggtgat
ttcagtaatggcaaagaagaccggccattatcggaaagagcaaaaatcaacgtcaataaa
aataacttcaacagcgtactttcggaattcagcccggaaatcagcctcacggtacagaac
acgctggccggcgatagcgccgaagaaaatattcagctccgcttcgccgatatgaaagat
ttcgaaccggagcaggtggcccgccagatcccccagctccgcgccatgctggcgatgcgg
aatttattacgcgacctcaaatccaacctccttgataacgccactttcagaaaagagctt
gagaaaatcctgaaagacccggcactgacgcaggaattacgcgacgaaatgagcgcgctg
gccccgaaataa

DBGET integrated database retrieval system