KEGG   Klebsiella michiganensis E718: A225_2629
Entry
A225_2629         CDS       T02173                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
koe  Klebsiella michiganensis E718
Pathway
koe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:koe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A225_2629
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:koe02044]
    A225_2629
Secretion system [BR:koe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A225_2629
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: AFN32187
Position
2774321..2774986
AA seq 221 aa
MKQDINIDALMADAWLTVTELRFGARLADGEGDRLWRHCVDHIEQVMAKLEAADVSEASR
RHILYAWCALLDETAKGREGEDDACIVWYDRPLQAKYFGALDAGDALYERMRQVLREPAP
DMVVLTCFHRVLMLGFKGCYALNEPARDQLVRVLTERVPPFETDQSRPVLAGISGRSGLA
DGLRRWPVCIGLSLVAIAALWWGLNHWLDSLIATLLPGAGK
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaaacaggacataaatatcgacgccctgatggcggacgcgtggctgacggtgacagaa
ctgcggttcggcgcaagactggccgacggggagggcgaccgcctgtggcgacattgtgta
gatcatattgaacaggtgatggcgaagctcgaggctgcggacgtcagcgaggcgagccgt
cggcatattctctacgcctggtgtgcgctgctggatgagaccgccaaaggacgcgaaggc
gaggatgatgcctgcatcgtctggtatgaccgtccgctgcaggcgaaatactttggtgct
ctggacgccggagatgctttgtatgaacggatgcgacaggttctgcgcgagcccgcgccg
gatatggtggtgctgacctgtttccaccgggtgctgatgctcggctttaaagggtgttat
gccctgaatgaaccggctcgtgaccagcttgttcgggtactgaccgagcgcgtgccgccg
tttgaaacggaccagagccgtcccgtactggcgggtatctccgggcgcagcggcctggcg
gacgggttacgtcgctggccggtttgcatcgggctgtcgctggtagcgatcgccgcgctg
tggtggggtctgaaccactggcttgattccctgattgcaaccctgctgccgggggccggg
aaatga

DBGET integrated database retrieval system