KEGG   Klebsiella michiganensis E718: A225_2639Help
Entry
A225_2639         CDS       T02173                                 

Definition
(GenBank) hypothetical protein
Organism
koe  Klebsiella michiganensis E718
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAAR_motif
Motif
Other DBs
NCBI-ProteinID: AFN32197
Position
2790074..2790352
Genome map
AA seq 92 aa AA seqDB search
MGAGNYLVVGDKTTCGGVITEGDATQTILGKAAAREGDKVTCGRHSGIYYIAGGMANDMV
NGRKMAGTQDSHSTCPCQARFIPSMMNDNYES
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgggtaactatttagtggtgggagataaaaccacctgtggcggggtgattact
gaaggtgatgccacgcagacgatactgggtaaagcggcggcacgcgagggagataaagtg
acctgcggcagacattccggcatttactacatcgcaggtggtatggcgaatgacatggtg
aacgggcgaaaaatggcgggaacgcaggatagtcacagtacctgcccgtgccaggcgagg
tttatcccttccatgatgaatgacaattacgaaagttga

DBGET integrated database retrieval system