KEGG   Klebsiella michiganensis E718: A225_2640
Entry
A225_2640         CDS       T02173                                 

Definition
(GenBank) Protein ImpG/VasA
  KO
K11896  type VI secretion system protein ImpG
Organism
koe  Klebsiella michiganensis E718
Brite
KEGG Orthology (KO) [BR:koe00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:koe02044]
    A225_2640
Secretion system [BR:koe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A225_2640
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AFN32198
Position
2790365..2792125
AA seq 586 aa
MDDLTLRYFDAEMRYLREAGEEFARAHPDRAAALNLDKSGARDPYVERLFEGFAFLMGRL
REKLDDDLPELTGGLVSMIWPHYLRTIPSLSIVEFTADWRELKEPVRVEKGFGILSQPIG
EKRTRCHYTTTQSLILQPLSLARAGISTEPDGRSLLRLRFECSPLADWSRIDLSRIPLYL
NGDAPLACALHEALTLRVAKTGIRFPGDADRRPLDARFAVCGFSREEALLPECGSFSGYQ
LLLEYFTFREKFMSVTLRGLENMDFPEELAWFEIDIVLERQWPHEYALSEKHLRLHCTPV
INLFPLESDPLHLDSLQTEYLLRPMRVQDGHTEIYSVDSVTSSRHSGHQTYVPFTSFRHK
GGMLRHDAPEYYYHTRVKSGPSGLHDTWLTLGGEAFDNHTVPENEKLSLSLTGTNGQLPR
RALQSTLLDTVVKSTTARIQVRNLCAPTLPCYPPDRDRFHWRVLSHLGSSFLWMMDNADV
LRGALALYDWTDNEMNRRRLEAIVDVRHSEVERFAQGHFLRGVQIEVTLDSSGFAGHGDI
CLFGEMLNRFFALYTDIHLFNHLILILQPGGERLEWQENHNRRIPG
NT seq 1761 nt   +upstreamnt  +downstreamnt
atggacgacttaaccctgcgttattttgacgccgaaatgcgttacctgcgtgaagcgggc
gaagagttcgcccgcgcccatcctgaccgggcggcggccttaaatctcgacaaatcgggc
gcgcgcgacccctatgtcgagcgcctgtttgaaggcttcgcctttctgatgggccgcctg
cgcgaaaagctcgacgacgatctgccggagctgaccggcggactggtgagcatgatctgg
ccacactacctgcgtaccattccgtcgctctccattgttgagttcaccgcggactggcgt
gaactgaaagaacctgtccgcgttgaaaaaggctttggaattctttctcagcccattggt
gaaaagcgcacccgctgccattacaccacgacgcagtcgctgatcctgcagcccctgtcg
ctcgcccgggcggggatctcgacggaaccggatgggcgctcgcttctccgcctgcgcttt
gagtgcagcccgctggcagactggagccgcatcgatttaagccgcatcccgctgtacctg
aatggcgacgcgccactggcctgcgccttgcatgaggcgctgacgctccgggtggcgaaa
acgggtatccgctttcccggcgatgctgaccgcagaccgctggacgcccgttttgccgtc
tgcggtttcagtagggaggaggcgctgctgccggagtgcggcagtttcagcggttatcag
ctgctgctggagtattttaccttccgtgaaaagtttatgtcggtgacgctgcgcggcctg
gaaaatatggatttcccggaagaactggcgtggtttgaaatcgatatcgtgctggagaga
cagtggccgcatgaatatgcgctgtcggagaaacatctgcgcctgcactgcacgccggtg
attaatctgtttccgctggagtccgatccgctgcatctggactcgttacagaccgaatac
ctgctgcgcccgatgcgtgtccaggacggtcataccgagatttattccgtggattcggtc
acctcctcgcgccactccggtcaccagacgtatgtgccgttcaccagcttccgtcacaag
ggaggaatgctgcgccatgatgcgccggaatattattaccatacgcgggtaaagtccggt
ccttcagggctgcacgacacctggctgacgctcggcggcgaggcgtttgataaccacacc
gtaccggagaatgaaaaactgtcgctcagcctgaccggcaccaacggccagctgccgcgc
cgggcgctgcagagtacgctgctggacacggtggtgaaatccaccaccgcgcgcattcag
gtgcgtaacctctgcgccccgacgctgccgtgctacccgccggaccgcgatcgttttcac
tggcgggtgctgagccatctcggcagcagtttcctgtggatgatggataacgccgacgtg
ctgcgcggcgcgctggccctctatgactggaccgataacgagatgaaccgccgccgcctg
gaagcgattgtcgatgtcaggcatagcgaggtggaacgttttgcacagggccattttctg
cgcggcgtgcagattgaggtgaccctcgacagcagcggcttcgccgggcacggcgatatc
tgcctgttcggcgagatgctgaaccgcttcttcgcgctgtataccgatattcacctgttc
aaccatctgattctgatactacaacctgggggagagcgcctcgaatggcaggagaaccac
aaccgccgcattcccggctaa

DBGET integrated database retrieval system