KEGG   Klebsiella michiganensis E718: A225_3375Help
Entry
A225_3375         CDS       T02173                                 

Definition
(GenBank) Uncharacterized protein ImpD
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
koe  Klebsiella michiganensis E718
Pathway
koe03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:koe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A225_3375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:koe02044]
    A225_3375
Secretion system [BR:koe02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A225_3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AFN32810
Position
complement(3557108..3557599)
Genome map
AA seq 163 aa AA seqDB search
MAIPVYLWLKDDGGADIKGSVDVQDREGSIEVIAQEHNLYIPTDNNTGKLTGTRIHTPFL
FTKEIDSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVSPEMYD
IKDPSKEKHNHLERVELRYEKITWTYKDGNIIHSDSWNERATA
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcctgtttatctttggctgaaagacgacggcggtgcggacattaaaggatct
gtggacgttcaggatcgcgagggcagcatcgaagttatcgctcaggagcataacctgtac
atcccgaccgataacaacaccggcaaactgaccggcacccgtatccacacgccgttcctg
ttcaccaaggaaatcgactcgtccagcccgtatctgtacaaggcggtgaccaccggtcag
accctcaagtctgcggaattcaagtggtacaagatcaacgacgcgggccaggaagtggag
tacttcaacaccaaactcgaaaacgtgaaggtggtgaaagtgagccctgaaatgtacgac
atcaaggatccttctaaagagaagcacaaccatcttgagcgcgtagaactgcgttacgaa
aaaatcacctggacctacaaagacggcaacatcattcattccgatagctggaacgaacgc
gccaccgcgtaa

DBGET integrated database retrieval system