KEGG   Klebsiella michiganensis E718: A225_3882Help
Entry
A225_3882         CDS       T02173                                 

Definition
(GenBank) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00030  Pentose phosphate pathway
koe00480  Glutathione metabolism
koe01100  Metabolic pathways
koe01110  Biosynthesis of secondary metabolites
koe01120  Microbial metabolism in diverse environments
koe01130  Biosynthesis of antibiotics
koe01200  Carbon metabolism
Module
koe_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
koe_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A225_3882
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A225_3882
Enzymes [BR:koe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     A225_3882
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     A225_3882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 ApbA F420_oxidored Shikimate_DH 3HCDH_N NAD_Gly3P_dh_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AFN29701
Position
complement(4079475..4080881)
Genome map
AA seq 468 aa AA seqDB search
MSKQQIGVVGMAVMGRNLALNIESRGYTVSVFNRSREKTEEVIAENPGKKLVPHYTVQEF
VESLETPRRILLMVKAGAGTDSAIDSLKPYLDKGDIIIDGGNTFFQDTIRRNRELSAEGF
NFIGTGVSGGEEGALKGPSIMPGGQKEAYELVAPILKQIAAVAEDGEPCVTYIGADGAGH
YVKMVHNGIEYGDMQLIAEAYALLKGGLALSNEELAQTFTEWNEGELSSYLIDITKDIFT
KKDEEGKYLVDVILDEAANKGTGKWTSQSSLDLGEPLSLITESVFARYISSLKDQRVAAS
KVLTGPQAKSAGDKAEFVEKVRRALYLGKIVSYAQGFSQLRAASDEYHWDLNYGEIAKIF
RAGCIIRAQFLQKITDAYEQNAGIANLLLAPYFKQIADDYQQALRDVVAYAVQNGIPVPT
FSAAIAYYDSYRSAVLPANLIQAQRDYFGAHTYKRTDKEGVFHTEWME
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaacagatcggggttgtcggtatggcagtgatggggcgtaaccttgcgctc
aacatcgaaagccgcggttataccgtctccgttttcaaccgctcccgtgaaaagaccgaa
gaagtgattgccgagaatccgggcaagaaactggtcccacattatacagtgcaagagttt
gttgagtcgctcgaaactccacgccgtatcctgttaatggtgaaggcgggcgcaggcact
gatagtgccatcgactctctgaagccttacctggacaagggtgacatcatcatcgatggt
ggtaataccttcttccaggatacgattcgtcgtaatcgtgagctttctgctgaaggtttt
aactttatcggaaccggcgtgtccggcggtgaagaaggggctcttaaaggtccttcgatt
atgcctggcgggcagaaagaagcttatgaactggttgctccaattctcaagcagattgct
gctgtcgctgaagacggtgagccgtgcgtaacctatatcggtgccgatggcgctggtcat
tatgtcaaaatggttcacaacggtattgaatacggtgatatgcagcttattgcagaagcc
tacgctttactgaaaggcgggctggcgctctctaatgaagagctggcgcaaacctttacc
gaatggaatgaaggtgagcttagcagctatctcattgacatcactaaagacatcttcacc
aaaaaagatgaagagggtaaatacctggtcgacgtgatcctcgatgaggcggcaaacaaa
ggtaccggcaaatggaccagccagagctctcttgacctcggtgaaccgctgtcacttatc
actgaatctgtattcgctcgctacatctcttctctgaaagatcagcgtgtggctgcttcg
aaagttcttaccggaccccaggcgaagagtgcaggcgataaagcggagttcgttgagaaa
gttcgccgcgctctgtatctgggcaaaatcgtctcttacgctcaaggtttctcgcagctg
cgcgcggcttctgatgaataccactgggatctgaactacggtgagatcgcgaaaatcttc
cgcgccggctgtattattcgtgctcagttcctgcaaaagattactgatgcctatgagcag
aatgccggtattgccaacctgctgctggctccatactttaagcagatcgccgatgattat
cagcaagccctgcgcgatgttgttgcatatgctgttcagaatggtattccggttccgacg
ttctctgcggccatcgcctactacgatagctatcgctctgcagtcttgcctgctaacctg
attcaggcgcagcgtgactattttggtgcgcatacctataagcgtaccgataaagaaggt
gtgttccatactgagtggatggaataa

DBGET integrated database retrieval system