KEGG   Klebsiella michiganensis E718: A225_4104Help
Entry
A225_4104         CDS       T02173                                 

Definition
(GenBank) ClpB protein
  KO
K03695  ATP-dependent Clp protease ATP-binding subunit ClpB
Organism
koe  Klebsiella michiganensis E718
Brite
KEGG Orthology (KO) [BR:koe00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:koe03110]
    A225_4104
Chaperones and folding catalysts [BR:koe03110]
 Heat shock proteins
  HSP100
   A225_4104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA AAA_16 NACHT TniB ATPase_2 Clp_N AAA_22 AAA_25 AAA_5 IstB_IS21 RsgA_GTPase AAA_7
Motif
Other DBs
NCBI-ProteinID: AFN33435
Position
complement(4326534..4327637)
Genome map
AA seq 367 aa AA seqDB search
MEVAASLCQTRAHAEILPEHWLLKLLELGEGDLTVLARRYEWDMDAIWQDLLAFLDTLPR
SVRSRPQLSDSIQTLMQDAWLHASLAGEEHIRSIHLLMALVDKPKLAHCDGLWPLLTLGQ
GQLERLRPLLDAQSDERPEVQQEAELAQNHGGEVEFVGSQVGAGIKEGELTPALQNALDK
FTIDVTAKAKEGKIDPVFGRDTEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRI
AEGNVPESLKPVVLRTLDLGLLQAGTGVKGEFEQRLKNVIDAVQKSLVPVPLFIDEAHTI
IGAGNQAGGADAANLLKPALARGELRTIAATTWSEYKQYFERDAALERRFQMVKVDEPDD
ETACMTR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggaagtggcagcttcgctctgccagacccgcgctcacgcggaaatcctgcctgagcac
tggctgctgaagctgctggagctgggagagggggacctgacggtgctggcacggcgctac
gaatgggatatggacgccatctggcaggatttgctggcatttctcgacacgctgccccgt
tcggtgcgcagccgtccgcagctctcagacagtattcagaccctgatgcaggacgcctgg
ctgcatgcctcgctggcgggtgaagagcacatccgcagcattcacctgctgatggcgctg
gtcgataaacctaaactggcacactgcgatggactgtggccgctgctgaccctcgggcag
ggccaacttgagcgtcttcgcccgttgctggatgcacagtcagatgagcgcccggaagtg
cagcaggaagccgaactggcacaaaatcacggtggtgaagtggaatttgtcggcagtcag
gtcggcgcggggataaaagaaggcgagctgactccggccctgcagaacgcactggataaa
tttaccattgatgtcaccgccaaagcgaaagagggcaagattgatccggtctttgggcgc
gatacggaaatccgccagatggtggacattctctcgcgccgccgcaagaacaacccgatc
ctggtcggtgagccgggcgtggggaagaccgccctggtggaagggctggcgctgcgtatt
gccgaaggcaacgtaccggaatccctcaagcctgtagttctacgtactctcgacctgggc
ctgcttcaggcggggactggtgtaaagggggagttcgagcagcgcctgaaaaacgtcatc
gatgccgtacagaagtcactggtaccggttccgctgtttatcgacgaagcccacaccatt
atcggtgccggcaaccaggccggcggggcggatgcggccaatctgctgaaaccggctctg
gcgcgtggcgaactgcgcaccatcgcggccaccacctggagcgaatataagcaatatttt
gaacgagatgccgcactggagcgccgcttccagatggtcaaagtggacgaaccggatgat
gaaacggcctgcatgacgcgctga

DBGET integrated database retrieval system