KEGG   Klebsiella michiganensis E718: A225_4205Help
Entry
A225_4205         CDS       T02173                                 

Definition
(GenBank) Histidine ABC transporter
  KO
K10017  histidine transport system ATP-binding protein [EC:7.4.2.1]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:koe00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    A225_4205
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:koe02000]
    A225_4205
Enzymes [BR:koe01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.1  ABC-type polar-amino-acid transporter
     A225_4205
Transporters [BR:koe02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Lysine/arginine/ornithine transporter
    A225_4205
   Histidine transporter
    A225_4205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_29 ABC_ATPase AAA_13 AAA_16 AAA_33 AAA_23 G-alpha PRK RsgA_GTPase AAA_24 AAA_22 DUF87
Motif
Other DBs
NCBI-ProteinID: AFN29742
Position
complement(4441262..4442035)
Genome map
AA seq 257 aa AA seqDB search
MSDNKLNVIDLHKRYGEHEVLKGVSLRAKAGDVISIIGSSGSGKSTFLRCINFLEKPSEG
TIVVNGQNIGLVRDKDGQLKVSDKNQLRLLRTRLTMVFQHFNLWSHMTVLENVMEAPIQV
LGLSKQEARDRAVKYLAKVGIDERQQIKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPT
SALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGHPDEVF
GNPKSQRLQQFLKGSLK
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacaataaattaaatgtaatcgatctgcataaacgttacggagagcatgaagta
ctgaagggcgtctcactgcgggcgaaagccggagacgtgatcagtattattggctcatcc
ggttccgggaaaagtacctttttgcgctgtattaactttcttgagaagcccagcgaaggg
acgatcgttgttaacgggcaaaacattggcctggttcgcgataaagacggtcagttaaag
gtttctgataaaaatcagctacgtttgctacgtactcgcctgacgatggtattccagcat
tttaacctgtggagccatatgacggtgctggaaaacgtgatggaggcgccgattcaggtg
ctgggcctgagtaaacaggaagcgcgcgatcgggcggtaaaatacctggcgaaagttggt
attgatgaacgccagcagattaaatatccggttcatctctccggcggccagcagcagcgc
gtttccattgcccgcgcgctggcgatggagcctgacgtactgctgtttgatgaaccgacg
tcggcgcttgaccctgaactggtgggcgaagtgctgcggatcatgcagcagctggcggaa
gaggggaaaaccatggtcgtggtcacccatgaaatgggctttgcacgccacgtctcctcg
cacgtgatcttcctgcatcagggcaaaattgaagaagaagggcatcctgacgaggttttc
ggcaatccgaaaagccagcgtctgcagcagttcctgaagggctctttgaagtaa

DBGET integrated database retrieval system