KEGG   Klebsiella michiganensis E718: A225_4211Help
Entry
A225_4211         CDS       T02173                                 

Definition
(GenBank) 3-polyprenyl-4-hydroxybenzoate carboxy-lyase UbiX
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
koe  Klebsiella michiganensis E718
Pathway
koe00130  Ubiquinone and other terpenoid-quinone biosynthesis
koe00627  Aminobenzoate degradation
koe01100  Metabolic pathways
koe01110  Biosynthesis of secondary metabolites
koe01120  Microbial metabolism in diverse environments
koe01220  Degradation of aromatic compounds
Module
koe_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:koe00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    A225_4211
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A225_4211
Enzymes [BR:koe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     A225_4211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AFN33527
Position
complement(4445623..4446210)
Genome map
AA seq 195 aa AA seqDB search
MKGAIIVKRLIIGISGASGAIYGVRLLQVLREVSDVETHLILSQAARQTLALETDFSLRE
VQALADVVHDARDIAASISSGSFKTAGMVILPCSMKTLSGIVHSYTDGLLTRAADVVLKE
RRPLVLCVRETPFHLGHLRLLVQAAEMGAVIMPPVPAFYHRPKSLDDVINQTVNRVIDQF
DISLPQDLFSRWQGA
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggggcaatcatcgtgaagcgactcattatcggtatttctggcgccagcggcgcg
atttacggcgtacgcttgctccaggttttgcgcgaggtttcggatgtcgaaacccatctt
attttaagccaggccgcgcgtcagacgctggcgctggagacggatttctccctgcgcgag
gtgcaggcgttagccgacgtggtgcacgatgcccgcgatatcgccgccagcatctcttcc
ggctcttttaaaaccgccgggatggtgattttgccatgctcaatgaagaccctctccggc
attgttcatagctataccgacgggctgctgaccagggcggcggacgtggtgcttaaagag
cgccgcccgctggtgctgtgcgtacgggaaacgccgttccaccttggccatttgcggctg
ctggtccaggcggcggaaatgggcgcggtgattatgccgccggttccggcgttttatcat
cgcccgaaaagcctggacgatgtgattaatcagacggtcaatcgcgtgatcgatcagttc
gatatctctcttccgcaagacctcttttcccgctggcagggcgcgtag

DBGET integrated database retrieval system